(data stored in ACNUC7421 zone)

EMBL: CP002355.PE511

CP002355.PE511       Location/Qualifiers
FT   CDS             complement(489501..490424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0512"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="COGs: COG0031 Cysteine synthase; InterProIPR005856:
FT                   IPR005859: IPR001926: IPR010916: IPR 001216; KEGG:
FT                   abu:Abu_2299 cysteine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   SPTR: Cysteine synthase; TIGRFAM: cysteine synthase A;
FT                   cysteine synthase; PFAM: Pyridoxal-phosphate dependent
FT                   enzyme; TIGRFAM: cysteine synthase A; cysteine synthases"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33179"
FT                   /db_xref="GOA:E4U014"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E4U014"
FT                   /protein_id="ADR33179.1"
FT                   /translation="MNIASNITELIGNTPLVRLNAPSDQNGATILGKCEFMNPTSSVKD
FT                   RIGFNMIKTAMEAGLINADTLIVEPTSGNTGIALASICAALGLKLTLTMPESMSIERRN
FT                   LLKALGANLVLTPAALGMKGAIDEADALVASNPNAIVLQQFANPANPAIHRVTTAQEIL
FT                   RDTDGKVDIFVAAVGTGGTLTGTGEALRAVLPNIQIIAVEPKDSPVLSGGKPGPHKIQG
FT                   IGAGFVPNVLNTSLYNEVITVSNEDAIAASKALAKTEGLLVGISAGANVHAAALVAARP
FT                   ENKGKTIVTILCDTAERYLSTPLFES"
     MNIASNITEL IGNTPLVRLN APSDQNGATI LGKCEFMNPT SSVKDRIGFN MIKTAMEAGL        60
     INADTLIVEP TSGNTGIALA SICAALGLKL TLTMPESMSI ERRNLLKALG ANLVLTPAAL       120
     GMKGAIDEAD ALVASNPNAI VLQQFANPAN PAIHRVTTAQ EILRDTDGKV DIFVAAVGTG       180
     GTLTGTGEAL RAVLPNIQII AVEPKDSPVL SGGKPGPHKI QGIGAGFVPN VLNTSLYNEV       240
     ITVSNEDAIA ASKALAKTEG LLVGISAGAN VHAAALVAAR PENKGKTIVT ILCDTAERYL       300
     STPLFES                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page