(data stored in ACNUC7421 zone)

EMBL: CP002355.PE512

CP002355.PE512       Location/Qualifiers
FT   CDS             490663..492120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0513"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding
FT                   protein"
FT                   /EC_number="6.4.1.1"
FT                   /note="COGs: COG4770 Acetyl/propionyl-CoA carboxylase alpha
FT                   subunit; InterProIPR005481: IPR005479: IPR005482:
FT                   IPR011761: IPR 011764; KEGG: abu:Abu_0605 acetyl CoA
FT                   carboxylase, biotin carboxylase subunit; PFAM:
FT                   Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; SPTR: Acetyl CoA
FT                   carboxylase, biotin carboxylase subunit; PFAM:
FT                   Carbamoyl-phosphate synthase L chain, ATP binding domain;
FT                   Biotin carboxylase C-terminal domain; Carbamoyl-phosphate
FT                   synthase L chain, N-terminal domain; TIGRFAM: acetyl-CoA
FT                   carboxylase, biotin carboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33180"
FT                   /db_xref="GOA:E4U015"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E4U015"
FT                   /protein_id="ADR33180.1"
FT                   /translation="MKTKKISKVLIANRGEIALRIIRACKELGIKSVVVFSEVDVNGVW
FT                   VRKADECYPIMGDPIAAYLDYERIISLAKKADCDAIHPGYGFLSESAEFAQACIDNGII
FT                   FIGPKPEHIALFGDKMASKVAMREVGVPMLPGTDEPIDNIEDAEKIAIDIGFPIIIKAA
FT                   FGGGGRGMRIVEKAEDFKEMYESATNEALRFFSRGEVFIEKYLKNPRHIEIQIVADKYG
FT                   NIVHLGDRDCSIQRRHQKVIEIAPSPLLNHETRRELYRISKKAMYRLGYESVGTIEYLV
FT                   DQDDNIYFIEMNTRVQVEHPVTEAISGIDLIQRMIQIAEGDQLKFMQEEIHLRGYAIEF
FT                   RINAENPKLGFVPSPGLITNYLAPGGPGVRLDSMAYTNYQIPSNYDSMIGKLIVTALTW
FT                   EDAVRKAARALDEFLIEGVPTNIPLHRQIVRDQDFIDGKIDTGYLDTKLQHFNLDAIHN
FT                   MDDEEAKMQHITAVIEAINKNNLNVRH"
     MKTKKISKVL IANRGEIALR IIRACKELGI KSVVVFSEVD VNGVWVRKAD ECYPIMGDPI        60
     AAYLDYERII SLAKKADCDA IHPGYGFLSE SAEFAQACID NGIIFIGPKP EHIALFGDKM       120
     ASKVAMREVG VPMLPGTDEP IDNIEDAEKI AIDIGFPIII KAAFGGGGRG MRIVEKAEDF       180
     KEMYESATNE ALRFFSRGEV FIEKYLKNPR HIEIQIVADK YGNIVHLGDR DCSIQRRHQK       240
     VIEIAPSPLL NHETRRELYR ISKKAMYRLG YESVGTIEYL VDQDDNIYFI EMNTRVQVEH       300
     PVTEAISGID LIQRMIQIAE GDQLKFMQEE IHLRGYAIEF RINAENPKLG FVPSPGLITN       360
     YLAPGGPGVR LDSMAYTNYQ IPSNYDSMIG KLIVTALTWE DAVRKAARAL DEFLIEGVPT       420
     NIPLHRQIVR DQDFIDGKID TGYLDTKLQH FNLDAIHNMD DEEAKMQHIT AVIEAINKNN       480
     LNVRH                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page