(data stored in ACNUC7421 zone)

EMBL: CP002355.PE514

CP002355.PE514       Location/Qualifiers
FT   CDS             493437..493703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0515"
FT                   /product="protein translocase subunit yajC"
FT                   /note="COGs: COG1862 Preprotein translocase subunit YajC;
FT                   InterPro IPR003849; KEGG: tdn:Suden_1576 preprotein
FT                   translocase subunit YajC; PFAM: YajC family protein; SPTR:
FT                   Preprotein translocase, YajC subunit; TIGRFAM: preprotein
FT                   translocase, YajC subunit; PFAM: Preprotein translocase
FT                   subunit; TIGRFAM: preprotein translocase, YajC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33182"
FT                   /db_xref="GOA:E4U017"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:E4U017"
FT                   /protein_id="ADR33182.1"
FT                   /translation="MEILSQILPFVFLIAIMYFVIIRPQNQQAKKHKEMIEALTKGDKI
FT                   ITTGGLIVEIKKVEDKFFMIKMNNETEARLVKDAVARKYEDEA"
     MEILSQILPF VFLIAIMYFV IIRPQNQQAK KHKEMIEALT KGDKIITTGG LIVEIKKVED        60
     KFFMIKMNNE TEARLVKDAV ARKYEDEA                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page