(data stored in ACNUC7421 zone)

EMBL: CP002355.PE515

CP002355.PE515       Location/Qualifiers
FT   CDS             493693..495270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0516"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="COGs: COG0342 Preprotein translocase subunit SecD;
FT                   InterPro IPR005791: IPR003335: IPR001036; KEGG:
FT                   tdn:Suden_1575 preprotein translocase subunit SecD; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; SPTR:
FT                   Protein-export membrane protein SecD; TIGRFAM:
FT                   protein-export membrane protein SecD; protein-export
FT                   membrane protein, SecD/SecF family; manually curated; PFAM:
FT                   Protein export membrane protein; SecD/SecF GG Motif;
FT                   TIGRFAM: protein-export membrane protein SecD;
FT                   protein-export membrane protein, SecD/SecF family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33183"
FT                   /db_xref="GOA:E4U018"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:E4U018"
FT                   /protein_id="ADR33183.1"
FT                   /translation="MKLNYRVVLLIIATVFGLIFSLPSFTQSSEGKKITLGLDLQGGLH
FT                   MLLGVKTEEAVNSQIKSIASGVKHFAERNDILIEGISVREGKVVFELLDGDDATTMDEH
FT                   LKTIEGTVVHASEGKYAISITPEAVEKLKLQAVDQAIETIRNRLDQFGLAEPTVAKQGI
FT                   DKILVELPGIKTAEEEQRARELISRAAKLELMAVDEDRSMRVNDLSEAEAASYGDRILE
FT                   DALQPQMKHLVNEIPILDGTMLTDAQVGYDQNNRPVINFSLNSAGAQVFGDFTGKSVGK
FT                   RLAIVLDGKVYSAPVINERIGGGSGQISGNYTVAEANDLAIALRSGALLAPIYMLEKRS
FT                   VGPSLGADSIKASLLALVSGFVLVMIFMIMYYGLAGIIANLAVVINIFIILAMMALLGA
FT                   TLTLPGMAGIVLHIGLAVDANIIINERVREQIRLGIGLKRALHEGYSKAMRAILDSNIT
FT                   QIIACTILYVYGTGAIKGFAVTLSMGILASMLTAIVGTYGIFQLFTNRIEKSKNYKMWF
FT                   GMTRKVNA"
     MKLNYRVVLL IIATVFGLIF SLPSFTQSSE GKKITLGLDL QGGLHMLLGV KTEEAVNSQI        60
     KSIASGVKHF AERNDILIEG ISVREGKVVF ELLDGDDATT MDEHLKTIEG TVVHASEGKY       120
     AISITPEAVE KLKLQAVDQA IETIRNRLDQ FGLAEPTVAK QGIDKILVEL PGIKTAEEEQ       180
     RARELISRAA KLELMAVDED RSMRVNDLSE AEAASYGDRI LEDALQPQMK HLVNEIPILD       240
     GTMLTDAQVG YDQNNRPVIN FSLNSAGAQV FGDFTGKSVG KRLAIVLDGK VYSAPVINER       300
     IGGGSGQISG NYTVAEANDL AIALRSGALL APIYMLEKRS VGPSLGADSI KASLLALVSG       360
     FVLVMIFMIM YYGLAGIIAN LAVVINIFII LAMMALLGAT LTLPGMAGIV LHIGLAVDAN       420
     IIINERVREQ IRLGIGLKRA LHEGYSKAMR AILDSNITQI IACTILYVYG TGAIKGFAVT       480
     LSMGILASML TAIVGTYGIF QLFTNRIEKS KNYKMWFGMT RKVNA                       525
//

If you have problems or comments...

PBIL Back to PBIL home page