(data stored in ACNUC7421 zone)

EMBL: CP002355.PE516

CP002355.PE516       Location/Qualifiers
FT   CDS             495270..496241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0517"
FT                   /product="protein translocase subunit secF"
FT                   /note="COGs: COG0341 Preprotein translocase subunit SecF;
FT                   InterPro IPR005665: IPR003335; KEGG: wsu:WS1247 preprotein
FT                   translocase subunit SecF; PFAM: SecD/SecF/SecDF export
FT                   membrane protein; SPTR: PROTEIN-EXPORT MEMBRANE PROTEIN
FT                   SECF; TIGRFAM: protein-export membrane protein SecF;
FT                   protein-export membrane protein, SecD/SecF family; PFAM:
FT                   Protein export membrane protein; SecD/SecF GG Motif;
FT                   TIGRFAM: protein-export membrane protein, SecD/SecF family;
FT                   protein-export membrane protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33184"
FT                   /db_xref="GOA:E4U019"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:E4U019"
FT                   /protein_id="ADR33184.1"
FT                   /translation="MELFKEDKVYNFLGKGKIFFVASFVLFFLAIALIATKGFSFGIDF
FT                   TGGTVVQVKYQGPAPIDKVREALEKDELFKHAAVSEFGSPEEIVIKTAASTDGLSKDIG
FT                   DVTREILKGTGEFEIRRVDMVGPKVGDELRVKGLTAFLLTLGAIMAMVTFRYEWRFALA
FT                   AIIAIVHDIVITFGFVSYFEIDFNIESVAALLMILGYSIHDTIIVYDRIREHIQESKNS
FT                   DFVMIVNEAVSRTQSRTTLTSLTVFFVVLTLFLFGGDIMLGFSFPMLVGVIIGTYSSIF
FT                   VAAQLVVWTGFSVGRYREKMAEKQKMQAEKEKMRAQFEQGIV"
     MELFKEDKVY NFLGKGKIFF VASFVLFFLA IALIATKGFS FGIDFTGGTV VQVKYQGPAP        60
     IDKVREALEK DELFKHAAVS EFGSPEEIVI KTAASTDGLS KDIGDVTREI LKGTGEFEIR       120
     RVDMVGPKVG DELRVKGLTA FLLTLGAIMA MVTFRYEWRF ALAAIIAIVH DIVITFGFVS       180
     YFEIDFNIES VAALLMILGY SIHDTIIVYD RIREHIQESK NSDFVMIVNE AVSRTQSRTT       240
     LTSLTVFFVV LTLFLFGGDI MLGFSFPMLV GVIIGTYSSI FVAAQLVVWT GFSVGRYREK       300
     MAEKQKMQAE KEKMRAQFEQ GIV                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page