(data stored in ACNUC7421 zone)

EMBL: CP002355.PE518

CP002355.PE518       Location/Qualifiers
FT   CDS             498722..499219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0519"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_1463 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33186"
FT                   /db_xref="UniProtKB/TrEMBL:E4U021"
FT                   /protein_id="ADR33186.1"
FT                   /translation="MKYWILSALIFLAGCGYQPSSHLAKNVVGDSVSTEVVIRMEDPQN
FT                   TVIIKDAVDMAVITRFRTALVPKNVSHTHLKIMINSVSFSPLRYDTNGYIITYRTAVVM
FT                   GISRTTAGKTANYTTSGVYDFDIEPNAIISDQARFEAIRQGAQKGIDVFIAQVSAQGSD
FT                   SK"
     MKYWILSALI FLAGCGYQPS SHLAKNVVGD SVSTEVVIRM EDPQNTVIIK DAVDMAVITR        60
     FRTALVPKNV SHTHLKIMIN SVSFSPLRYD TNGYIITYRT AVVMGISRTT AGKTANYTTS       120
     GVYDFDIEPN AIISDQARFE AIRQGAQKGI DVFIAQVSAQ GSDSK                       165
//

If you have problems or comments...

PBIL Back to PBIL home page