(data stored in ACNUC7421 zone)

EMBL: CP002355.PE519

CP002355.PE519       Location/Qualifiers
FT   CDS             499229..500764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0520"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG3706 Response regulator containing a
FT                   CheY-like receiver domain and a GGDEF domain; InterPro
FT                   IPR000160; KEGG: tdn:Suden_1570 diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; SMART: GGDEF domain
FT                   containing protein; SPTR: Diguanylate cyclase; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain; TIGRFAM:
FT                   diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33187"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E4U022"
FT                   /protein_id="ADR33187.1"
FT                   /translation="MTINQIVRNTVERLKAEGKVWTPDVYAETFCAEAKKAGFAVEDCS
FT                   GIDRYVALMDKKTLDEIKQYRVRTTAELIRFLISKLSRMNPNEATILVELLSGLAKKMA
FT                   QSIDLLHNPDASALAKKTIAILESQGGSTQIDLLKQAWTNFLSVYDDSFLMKLAHFGSV
FT                   DSTNLRSTIEGLKFKTSQGGGVDYDRTIRILISSLVPSIAPTMDDTTIELSQKLHSNPA
FT                   YIATDECEKEIKTAIAMRIALDKHSVEEMVHALDVLLDKLSVQLIDLIERSESSSSEIR
FT                   EVKRDLEALESHKPADFKTAHKRLYTIASTLEERVEVLSKDLKVHNEKVNQMGKKIATL
FT                   EAELAQATQASREDFLTKLFNKRAIEEYLNLKEAEYERHGHSFCVAMLDLDHFKAVNDT
FT                   YGHEAGDAVLIAFAKILKLEARNSDIVGRYGGEEFLAILGDTDLEGAKIFCEKVRAHVE
FT                   QAHFMYQGQRIAVSISIGVAQRSNFPSLKALISGADERLYDAKRKGRNRVEPA"
     MTINQIVRNT VERLKAEGKV WTPDVYAETF CAEAKKAGFA VEDCSGIDRY VALMDKKTLD        60
     EIKQYRVRTT AELIRFLISK LSRMNPNEAT ILVELLSGLA KKMAQSIDLL HNPDASALAK       120
     KTIAILESQG GSTQIDLLKQ AWTNFLSVYD DSFLMKLAHF GSVDSTNLRS TIEGLKFKTS       180
     QGGGVDYDRT IRILISSLVP SIAPTMDDTT IELSQKLHSN PAYIATDECE KEIKTAIAMR       240
     IALDKHSVEE MVHALDVLLD KLSVQLIDLI ERSESSSSEI REVKRDLEAL ESHKPADFKT       300
     AHKRLYTIAS TLEERVEVLS KDLKVHNEKV NQMGKKIATL EAELAQATQA SREDFLTKLF       360
     NKRAIEEYLN LKEAEYERHG HSFCVAMLDL DHFKAVNDTY GHEAGDAVLI AFAKILKLEA       420
     RNSDIVGRYG GEEFLAILGD TDLEGAKIFC EKVRAHVEQA HFMYQGQRIA VSISIGVAQR       480
     SNFPSLKALI SGADERLYDA KRKGRNRVEP A                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page