(data stored in ACNUC7421 zone)

EMBL: CP002355.PE52

CP002355.PE52        Location/Qualifiers
FT   CDS             49637..51085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0052"
FT                   /product="cytochrome c oxidase accessory protein CcoG"
FT                   /note="COGs: COG0348 Polyferredoxin; InterPro IPR017900:
FT                   IPR014116: IPR017896; KEGG: tdn:Suden_2030 4Fe-4S
FT                   ferredoxin, iron-sulfur binding; SPTR: 4Fe-4S ferredoxin,
FT                   iron-sulfur binding; TIGRFAM: cytochrome c oxidase
FT                   accessory protein CcoG; PFAM: Ubp3 associated protein Bre5;
FT                   TIGRFAM: cytochrome c oxidase accessory protein FixG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32720"
FT                   /db_xref="GOA:E4TWA4"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA4"
FT                   /protein_id="ADR32720.1"
FT                   /translation="MSNETTPTGKEYLSGWTPWRIKRYWFYGLVTIISLVIPWITINGN
FT                   HLFLLSFDKLKLHLMFVQFDMQELYLMPFLLMILFIGIFGITVLGGRVFCGWICPQTIF
FT                   RVVYRDLIETKLLGLRKRIKNKQQEPDYSKPENKLKRLVAILLWTGLAFIAASDLMWYF
FT                   VPPEDFLAYIQNPAEHTVLIGSILGIVAFLVYDVIFLKENFCVYVCPYSRIQSVLYDDD
FT                   TVMAIYNPNRGGDIYNEHKEKIFTKQNDLLSVNPKAECTTCESCVTVCPTHIDIRKGLQ
FT                   LECINCLECVDACTEVMGKLGKPSLVEWSSEKETLFMKGKTQYFRPKILGYITVLVVVS
FT                   IILAMMGSKKEYMLLNINKENRLYSIHNDDGKVKVENAYTFLLQNTLNEDHDYYFDVVA
FT                   PAGMEGKIKIEEPEEAFTVKPGVVKKKVVVLYTDEILVNDERKDTVIPITINAYAVDAK
FT                   DKVAVTRQSTFTFPRADLLKEEED"
     MSNETTPTGK EYLSGWTPWR IKRYWFYGLV TIISLVIPWI TINGNHLFLL SFDKLKLHLM        60
     FVQFDMQELY LMPFLLMILF IGIFGITVLG GRVFCGWICP QTIFRVVYRD LIETKLLGLR       120
     KRIKNKQQEP DYSKPENKLK RLVAILLWTG LAFIAASDLM WYFVPPEDFL AYIQNPAEHT       180
     VLIGSILGIV AFLVYDVIFL KENFCVYVCP YSRIQSVLYD DDTVMAIYNP NRGGDIYNEH       240
     KEKIFTKQND LLSVNPKAEC TTCESCVTVC PTHIDIRKGL QLECINCLEC VDACTEVMGK       300
     LGKPSLVEWS SEKETLFMKG KTQYFRPKIL GYITVLVVVS IILAMMGSKK EYMLLNINKE       360
     NRLYSIHNDD GKVKVENAYT FLLQNTLNED HDYYFDVVAP AGMEGKIKIE EPEEAFTVKP       420
     GVVKKKVVVL YTDEILVNDE RKDTVIPITI NAYAVDAKDK VAVTRQSTFT FPRADLLKEE       480
     ED                                                                      482
//

If you have problems or comments...

PBIL Back to PBIL home page