(data stored in ACNUC7421 zone)

EMBL: CP002355.PE53

CP002355.PE53        Location/Qualifiers
FT   CDS             51150..52370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0053"
FT                   /product="HI0933 family protein"
FT                   /note="COGs: COG2081 flavoprotein; InterPro IPR004792:
FT                   IPR013027; KEGG: tdn:Suden_0754 HI0933-like protein; PFAM:
FT                   HI0933 family protein; SPTR: HI0933-like protein; PFAM:
FT                   HI0933-like protein; TIGRFAM: flavoprotein, HI0933 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32721"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA5"
FT                   /protein_id="ADR32721.1"
FT                   /translation="MKTVAIIGGGASGLMAGLFAARAGANVTLYEQNNGVGKKILASGN
FT                   GRCNIINTTSSADDFAGTDPHFVTYALKQLNFTYFEKLCLSMGLVLDIKEDGRCYPLSN
FT                   EAKSVLIALKSAASDAGVHIRTDNSVSDISKKDAQFIVETPTDKKYFDAVLIATGSEAA
FT                   PQLGASADGYRFAEKFGHEIVPTYPSLVQLHLNSKHHHKMAGVKTTAEVTLIIDGKSKE
FT                   KIQGDILFAAYGISGLAILDISQKASYALLNKQRVSISLNLLPRYDRQSLINIVEKLFA
FT                   SVPKHDVHTALCGLMPAKIATYLLDDAGIALSAPVSALNPKEIKKLSHLIGEWKFEVNG
FT                   THGFKHAEVSGGGVSTAQINNKTMESKLVEGLYFAGEVLDIVGKRGGYNFNFAWASGMI
FT                   AGKEMAK"
     MKTVAIIGGG ASGLMAGLFA ARAGANVTLY EQNNGVGKKI LASGNGRCNI INTTSSADDF        60
     AGTDPHFVTY ALKQLNFTYF EKLCLSMGLV LDIKEDGRCY PLSNEAKSVL IALKSAASDA       120
     GVHIRTDNSV SDISKKDAQF IVETPTDKKY FDAVLIATGS EAAPQLGASA DGYRFAEKFG       180
     HEIVPTYPSL VQLHLNSKHH HKMAGVKTTA EVTLIIDGKS KEKIQGDILF AAYGISGLAI       240
     LDISQKASYA LLNKQRVSIS LNLLPRYDRQ SLINIVEKLF ASVPKHDVHT ALCGLMPAKI       300
     ATYLLDDAGI ALSAPVSALN PKEIKKLSHL IGEWKFEVNG THGFKHAEVS GGGVSTAQIN       360
     NKTMESKLVE GLYFAGEVLD IVGKRGGYNF NFAWASGMIA GKEMAK                      406
//

If you have problems or comments...

PBIL Back to PBIL home page