(data stored in ACNUC7421 zone)

EMBL: CP002355.PE54

CP002355.PE54        Location/Qualifiers
FT   CDS             complement(52516..54318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0054"
FT                   /product="GTP-binding protein TypA"
FT                   /note="COGs: COG1217 membrane GTPase involved in stress
FT                   response; InterProIPR005829: IPR000795: IPR005225:
FT                   IPR006298: IPR 004161: IPR000640; KEGG: tdn:Suden_0006
FT                   GTP-binding protein TypA; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein;
FT                   elongation factor G domain-containing protein; SPTR:
FT                   GTP-binding protein TypA; TIGRFAM: GTP-binding protein
FT                   TypA; small GTP-binding protein; PFAM: Elongation factor Tu
FT                   domain 2; Elongation factor G C-terminus; Elongation factor
FT                   Tu GTP binding domain; TIGRFAM: GTP-binding protein
FT                   TypA/BipA; small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32722"
FT                   /db_xref="GOA:E4TWA6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA6"
FT                   /protein_id="ADR32722.1"
FT                   /translation="MQKIRNIAVIAHVDHGKTTLVDGLLKQSGTFGTHEQVNERAMDSN
FT                   ALEKERGITILSKNTAIRYGDHKINIIDTPGHADFGGEVERVLKMVDGALILVDAYEGV
FT                   MPQTKFVVKKMLGLGIKPIVVINKIDKPSADPERVVDEVFDLFVAMDATEDQLDFPIIY
FT                   AAARDGIAKMDMADPDGDFTCMFNTILEKVPEPTGDAANPTQLQVFTLDYDNYVGKIGI
FT                   ARIFNGKIAKGDNILLAKADGEMVKGKISKLIGFLGLNRMEIQEAEAGDIVAVAGIETV
FT                   DVGDTICDPQNPMPLDPMHIEEPTLTVVFSVNDSPLAGQEGKHVTANKIRERLDAEMNT
FT                   NVAMRYETVGEGKFIVSGRGELQITILAENMRREGFEFGIGRPEVIVKEIEGVKCEPFE
FT                   HLVVDLPADFAGTIIERLGRRKAEMKAMVPMGEGFTRVEFEIPARGLIGFRGQFLTDTK
FT                   GEGVMNHSFLEFRPYTGNVESRQYGALISTEDGVALAYSLFNLQDRGVLFTAPQTKVYK
FT                   GMIIGEHSRSNDLDVNPIKGKAQSNVRSSGADEAIKLVPPRDMNLERALEWIEDDELLE
FT                   VTPLNIRIRKRWLDPTDRKRYGKK"
     MQKIRNIAVI AHVDHGKTTL VDGLLKQSGT FGTHEQVNER AMDSNALEKE RGITILSKNT        60
     AIRYGDHKIN IIDTPGHADF GGEVERVLKM VDGALILVDA YEGVMPQTKF VVKKMLGLGI       120
     KPIVVINKID KPSADPERVV DEVFDLFVAM DATEDQLDFP IIYAAARDGI AKMDMADPDG       180
     DFTCMFNTIL EKVPEPTGDA ANPTQLQVFT LDYDNYVGKI GIARIFNGKI AKGDNILLAK       240
     ADGEMVKGKI SKLIGFLGLN RMEIQEAEAG DIVAVAGIET VDVGDTICDP QNPMPLDPMH       300
     IEEPTLTVVF SVNDSPLAGQ EGKHVTANKI RERLDAEMNT NVAMRYETVG EGKFIVSGRG       360
     ELQITILAEN MRREGFEFGI GRPEVIVKEI EGVKCEPFEH LVVDLPADFA GTIIERLGRR       420
     KAEMKAMVPM GEGFTRVEFE IPARGLIGFR GQFLTDTKGE GVMNHSFLEF RPYTGNVESR       480
     QYGALISTED GVALAYSLFN LQDRGVLFTA PQTKVYKGMI IGEHSRSNDL DVNPIKGKAQ       540
     SNVRSSGADE AIKLVPPRDM NLERALEWIE DDELLEVTPL NIRIRKRWLD PTDRKRYGKK       600
//

If you have problems or comments...

PBIL Back to PBIL home page