(data stored in ACNUC7421 zone)

EMBL: CP002355.PE55

CP002355.PE55        Location/Qualifiers
FT   CDS             54496..55902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0055"
FT                   /product="Flagellar hook-length control protein-like,
FT                   C-terminal domain"
FT                   /note="InterPro IPR021136; KEGG: tdn:Suden_0029 flagellar
FT                   hook-length control protein; PFAM: Flagellar hook-length
FT                   control protein-like, C-terminal domain; SPTR: Flagellar
FT                   hook-length control protein; PFAM: Flagellar hook-length
FT                   control protein FliK"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32723"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA7"
FT                   /protein_id="ADR32723.1"
FT                   /translation="MIVQSKENKSQGSLVDLLGGNTKNSSAAKSNDLFSKLLASIGIQG
FT                   KGDENKIVKTNDFKAVIDPKNKSAAIPTSTTELKASQMKELQTLLSGKEGKEATLVSTE
FT                   LLENMTNDQMRTLINRAKDYLKNEISAKSPEYQADPKSLPKTLGALVKLAEKLGLEPQS
FT                   ISLATIVNEPEEKASFSNELLSKPLFEAKAIAALPATVMEESAPIEAITQLLSELKNKE
FT                   QKNTKPLSTETSVQEKSDKAETQPLTTLLQAMDKKEEKTASTSVSEKVDPIKIASTPTA
FT                   ATNKTDALIALLKESNDAKEIKSESIKVEGESSKSLHVPKADSLEVKAKEAQQSMRHFA
FT                   SDLKEAVQEYKPPFTRLTMKLNPEKLGEVEVTLVQRGNNVHVNIQSNNANSVAFLAHNA
FT                   TELKAQLASQGIQNATMNFMSGGDSQNQQAGQQQQQGQQQRFRAYESFEELNLNEEQIS
FT                   ALEIIIPHYA"
     MIVQSKENKS QGSLVDLLGG NTKNSSAAKS NDLFSKLLAS IGIQGKGDEN KIVKTNDFKA        60
     VIDPKNKSAA IPTSTTELKA SQMKELQTLL SGKEGKEATL VSTELLENMT NDQMRTLINR       120
     AKDYLKNEIS AKSPEYQADP KSLPKTLGAL VKLAEKLGLE PQSISLATIV NEPEEKASFS       180
     NELLSKPLFE AKAIAALPAT VMEESAPIEA ITQLLSELKN KEQKNTKPLS TETSVQEKSD       240
     KAETQPLTTL LQAMDKKEEK TASTSVSEKV DPIKIASTPT AATNKTDALI ALLKESNDAK       300
     EIKSESIKVE GESSKSLHVP KADSLEVKAK EAQQSMRHFA SDLKEAVQEY KPPFTRLTMK       360
     LNPEKLGEVE VTLVQRGNNV HVNIQSNNAN SVAFLAHNAT ELKAQLASQG IQNATMNFMS       420
     GGDSQNQQAG QQQQQGQQQR FRAYESFEEL NLNEEQISAL EIIIPHYA                    468
//

If you have problems or comments...

PBIL Back to PBIL home page