(data stored in ACNUC7421 zone)

EMBL: CP002355.PE56

CP002355.PE56        Location/Qualifiers
FT   CDS             55918..56592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0056"
FT                   /product="flagellar hook capping protein"
FT                   /note="COGs: COG1843 Flagellar hook capping protein;
FT                   InterPro IPR005648; KEGG: tdn:Suden_0030 flagellar hook
FT                   capping protein; PFAM: flagellar hook capping protein;
FT                   SPTR: Flagellar hook capping protein; PFAM: Flagellar hook
FT                   capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32724"
FT                   /db_xref="GOA:E4TWA8"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA8"
FT                   /protein_id="ADR32724.1"
FT                   /translation="MAINAYGAYTTDAAYTGATTAATNEDKSSLGKDDFLKLLLLELKY
FT                   QDPTSPMDSEKILSQTSQLATLESTENTNKALETLAASLTSSMQYSGISAIGKMADTGS
FT                   NAIVKEKDTSATFEIYFPEKVASGKVNILDSAGKVLRSIEIAETAAGTAQYKWDGKDNG
FT                   GTLLEEGIYYVESTYTKTDGTSATARVGRYPIESIKFEGGTTYAKLGSSYVDFSTIKEI
FT                   TN"
     MAINAYGAYT TDAAYTGATT AATNEDKSSL GKDDFLKLLL LELKYQDPTS PMDSEKILSQ        60
     TSQLATLEST ENTNKALETL AASLTSSMQY SGISAIGKMA DTGSNAIVKE KDTSATFEIY       120
     FPEKVASGKV NILDSAGKVL RSIEIAETAA GTAQYKWDGK DNGGTLLEEG IYYVESTYTK       180
     TDGTSATARV GRYPIESIKF EGGTTYAKLG SSYVDFSTIK EITN                        224
//

If you have problems or comments...

PBIL Back to PBIL home page