(data stored in ACNUC7421 zone)

EMBL: CP002355.PE59

CP002355.PE59        Location/Qualifiers
FT   CDS             60578..61084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0059"
FT                   /product="RDD domain containing protein"
FT                   /note="InterPro IPR010432; KEGG: tdn:Suden_1918 RDD
FT                   protein; PFAM: RDD domain containing protein; SPTR: RDD
FT                   protein; PFAM: RDD family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32727"
FT                   /db_xref="GOA:E4TWB1"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB1"
FT                   /protein_id="ADR32727.1"
FT                   /translation="MRWRTLKQTNKIKTPVKPKIDYAPFWSRAAGFATDIFMIGLPISL
FT                   ITMMMFGYDQMHTAGGLDVLVHDPKAQTNPPNPIASLLQIALFLITYVWFWHKSGQTPG
FT                   KKLARIRVVDAKTMDNASYWKLSLRFIGYFFSFITLVGFFIGLLRKDKRALHDLISGTA
FT                   VIRVP"
     MRWRTLKQTN KIKTPVKPKI DYAPFWSRAA GFATDIFMIG LPISLITMMM FGYDQMHTAG        60
     GLDVLVHDPK AQTNPPNPIA SLLQIALFLI TYVWFWHKSG QTPGKKLARI RVVDAKTMDN       120
     ASYWKLSLRF IGYFFSFITL VGFFIGLLRK DKRALHDLIS GTAVIRVP                    168
//

If you have problems or comments...

PBIL Back to PBIL home page