(data stored in ACNUC7421 zone)

EMBL: CP002355.PE63

CP002355.PE63        Location/Qualifiers
FT   CDS             complement(63725..64087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0063"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR000209; KEGG: tdn:Suden_0048
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: Domain of unknown function (DUF309)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32731"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB5"
FT                   /protein_id="ADR32731.1"
FT                   /translation="MATEPTGITESCEAFVLSISEGRYYDAHEDLEPLWYPRRFEDNNE
FT                   VRLWKGFINAAVSFELAKRGRKEASAKAWQTYLKYFSLLENLVTPHKELYVKIAKLLEK
FT                   KHGMLCASAALSRTQR"
     MATEPTGITE SCEAFVLSIS EGRYYDAHED LEPLWYPRRF EDNNEVRLWK GFINAAVSFE        60
     LAKRGRKEAS AKAWQTYLKY FSLLENLVTP HKELYVKIAK LLEKKHGMLC ASAALSRTQR       120
//

If you have problems or comments...

PBIL Back to PBIL home page