(data stored in ACNUC7421 zone)

EMBL: CP002355.PE66

CP002355.PE66        Location/Qualifiers
FT   CDS             complement(67262..68266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0066"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG2206 HD-GYP domain; InterPro IPR006674:
FT                   IPR003607; KEGG: ant:Arnit_2276 metal dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region; SPTR: HD-GYP domain; PFAM: HD domain; TIGRFAM:
FT                   uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32734"
FT                   /db_xref="GOA:E4TWB8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB8"
FT                   /protein_id="ADR32734.1"
FT                   /translation="MDVRKVRIVRRHDERPNIMYVEIEKWLLDIGDVLEFDLFMAEGKL
FT                   TEKTLLLSKHIPINSDIKIEIDSRHAIYVRQSDLEAYNIFVDKIAQAVARNEHIPVIKK
FT                   AAIIYRQASVILDEMFENPEELENVPKTKKVVNTFVNTIFSDTHAIESMIKITAYDYYT
FT                   HTHSINVCIYSLSLGSYLELNSITLQELGMSALLHDLGKSRVDPKITNKKGRLTEDEFD
FT                   EMKHHPLYGHTIALKIGIRDNRILDGIRHHHEKLDGSGYPDGLMGNSITLFARIIAVCD
FT                   VFDALSTQRSYKERMSSYDTLLLMKKTMQHHLDMVLVDSFIKMQQHSDALTAL"
     MDVRKVRIVR RHDERPNIMY VEIEKWLLDI GDVLEFDLFM AEGKLTEKTL LLSKHIPINS        60
     DIKIEIDSRH AIYVRQSDLE AYNIFVDKIA QAVARNEHIP VIKKAAIIYR QASVILDEMF       120
     ENPEELENVP KTKKVVNTFV NTIFSDTHAI ESMIKITAYD YYTHTHSINV CIYSLSLGSY       180
     LELNSITLQE LGMSALLHDL GKSRVDPKIT NKKGRLTEDE FDEMKHHPLY GHTIALKIGI       240
     RDNRILDGIR HHHEKLDGSG YPDGLMGNSI TLFARIIAVC DVFDALSTQR SYKERMSSYD       300
     TLLLMKKTMQ HHLDMVLVDS FIKMQQHSDA LTAL                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page