(data stored in ACNUC7421 zone)

EMBL: CP002355.PE67

CP002355.PE67        Location/Qualifiers
FT   CDS             complement(68273..68896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0067"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0040 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32735"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB9"
FT                   /protein_id="ADR32735.1"
FT                   /translation="MKKMTIADAAEYFNVSKEAIHNRIRRGSLDCIVDNGVKYVAVESA
FT                   KSGTSTTVASDARYTQYIEQENERLREKVDVLEKETNRLRDQREQMLIDERIKVEQIYK
FT                   ERDAQLRSVLHVVATKFLAHASVDAVMEEAKGVDAINADVVEGNEEEWVSLKSFLKLKR
FT                   YSDKEKKKIKNRFEALRENDIRLTVREGKIFLNPSEYDYSDLLR"
     MKKMTIADAA EYFNVSKEAI HNRIRRGSLD CIVDNGVKYV AVESAKSGTS TTVASDARYT        60
     QYIEQENERL REKVDVLEKE TNRLRDQREQ MLIDERIKVE QIYKERDAQL RSVLHVVATK       120
     FLAHASVDAV MEEAKGVDAI NADVVEGNEE EWVSLKSFLK LKRYSDKEKK KIKNRFEALR       180
     ENDIRLTVRE GKIFLNPSEY DYSDLLR                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page