(data stored in ACNUC7421 zone)

EMBL: CP002355.PE69

CP002355.PE69        Location/Qualifiers
FT   CDS             complement(69856..70353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0069"
FT                   /product="protein of unknown function DUF520"
FT                   /note="COGs: COG1666 conserved hypothetical protein;
FT                   InterPro IPR007551; KEGG: tdn:Suden_0039 putative
FT                   nucleotide-binding protein; PFAM: protein of unknown
FT                   function DUF520; SPTR: UPF0234 protein Suden_0039; PFAM:
FT                   Protein of unknown function (DUF520)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32737"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWC1"
FT                   /protein_id="ADR32737.1"
FT                   /translation="MASEHSLDISAKIDLQAFKDAIAQAEKEVIGRYDFKGITYEINYR
FT                   EKEKQLILLASSDNKLDALKDIVIGKLIKRGLSSKALNELKTEDASGGARKATYKIVDT
FT                   IDAKEAKKIVAEIKNLKTKATAQIEGEHIRVKSKQIDELQKIMAAIKGMEWEAPLVFDN
FT                   FR"
     MASEHSLDIS AKIDLQAFKD AIAQAEKEVI GRYDFKGITY EINYREKEKQ LILLASSDNK        60
     LDALKDIVIG KLIKRGLSSK ALNELKTEDA SGGARKATYK IVDTIDAKEA KKIVAEIKNL       120
     KTKATAQIEG EHIRVKSKQI DELQKIMAAI KGMEWEAPLV FDNFR                       165
//

If you have problems or comments...

PBIL Back to PBIL home page