(data stored in ACNUC7421 zone)

EMBL: CP002355.PE70

CP002355.PE70        Location/Qualifiers
FT   CDS             complement(70408..71109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0070"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="COGs: COG0479 Succinate dehydrogenase/fumarate
FT                   reductase Fe-S protein subunit; InterProIPR006058:
FT                   IPR017900: IPR004489: IPR001041: IPR 017896; KEGG:
FT                   tdn:Suden_0038 succinate dehydrogenase/fumarate reductase
FT                   iron-sulfur protein; PFAM: ferredoxin; SPTR: Fumarate
FT                   reductase iron-sulfur protein; TIGRFAM: succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein;
FT                   PFAM: 2Fe-2S iron-sulfur cluster binding domain; TIGRFAM:
FT                   succinate dehydrogenase and fumarate reductase iron-sulfur
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32738"
FT                   /db_xref="GOA:E4TWQ7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWQ7"
FT                   /protein_id="ADR32738.1"
FT                   /translation="MNISIKRSNNDEVQIYNVELENTTLLAVLNYIKTKIDPTLTYSHG
FT                   CRSGVCGSCAVRVNGREQLMCEYKPKDGDVIEPIRNTRVIRDLVVDTAFVERFNQAGEA
FT                   WIGSAREENISVEEMERIETQSDCILCTSCFSACPVYAVNPDFIGPFALTRVWRYVNDP
FT                   REGDSSAKIAAVQTNGIWDCTLCGECVPVCPQGIAPKQDISMLRTKSAMAGYSDPNMSF
FT                   GGGLDFGSPMF"
     MNISIKRSNN DEVQIYNVEL ENTTLLAVLN YIKTKIDPTL TYSHGCRSGV CGSCAVRVNG        60
     REQLMCEYKP KDGDVIEPIR NTRVIRDLVV DTAFVERFNQ AGEAWIGSAR EENISVEEME       120
     RIETQSDCIL CTSCFSACPV YAVNPDFIGP FALTRVWRYV NDPREGDSSA KIAAVQTNGI       180
     WDCTLCGECV PVCPQGIAPK QDISMLRTKS AMAGYSDPNM SFGGGLDFGS PMF              233
//

If you have problems or comments...

PBIL Back to PBIL home page