(data stored in ACNUC7421 zone)

EMBL: CP002355.PE72

CP002355.PE72        Location/Qualifiers
FT   CDS             complement(71243..72844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0072"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="COGs: COG1053 Succinate dehydrogenase/fumarate
FT                   reductase flavoprotein subunit; InterPro IPR013027:
FT                   IPR003953: IPR004112; KEGG: nis:NIS_0006 succinate
FT                   dehydrogenase/fumarate reductase, flavoprotein subunit;
FT                   PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; PRIAM: L-aspartate oxidase;
FT                   SPTR: Succinate dehydrogenase flavoprotein subunit; PFAM:
FT                   domain; FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32740"
FT                   /db_xref="GOA:E4TWQ9"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWQ9"
FT                   /protein_id="ADR32740.1"
FT                   /translation="MSKVLIVGSGGAGLVSALSATESGAKVIVASKTLPTRSQTSMAQG
FT                   GMNAVFGSEDSIENHIADTLRSSAGLGEEGRIALMCEKAPEAVRWCNTIGLPFSRDEKG
FT                   EIARRTLGGASAPRACYAQDYTGLKLLHTLYDQCLKAGIEFRNDRFLLNLIVDQETNRA
FT                   LGATFLHIETGEVEEIRADAVILATGGYGALYGKHSTNSVQATGDGLAAAVRAGARLAD
FT                   MEFIQFHPTALKNSSILISESARGAGGYLVDSEGERFTDELAPRDVVARAIHDEMAKSG
FT                   AVYLDIRHLGEDFINHELPQERKLAQIYEGIDPVHELIPIKPSAHYSMGGIEVNEKCMT
FT                   SVSALFAVGECANHKTHGANRLGGNSLLELVVFGRECGKNAAEYGALHPAPVLENMQLA
FT                   KDTNFVRGVMYFTNQIDFYQKQEMLANIFYNNVGLVRDDMGLKAVLGAIRQMQKELPFM
FT                   GPRDKSKVCNTNLVEFIEFGNKIELAEIIVVSAISRVESRGAHYRLDAPERNDRMFGAH
FT                   TITWKEDGVLCADFIQ"
     MSKVLIVGSG GAGLVSALSA TESGAKVIVA SKTLPTRSQT SMAQGGMNAV FGSEDSIENH        60
     IADTLRSSAG LGEEGRIALM CEKAPEAVRW CNTIGLPFSR DEKGEIARRT LGGASAPRAC       120
     YAQDYTGLKL LHTLYDQCLK AGIEFRNDRF LLNLIVDQET NRALGATFLH IETGEVEEIR       180
     ADAVILATGG YGALYGKHST NSVQATGDGL AAAVRAGARL ADMEFIQFHP TALKNSSILI       240
     SESARGAGGY LVDSEGERFT DELAPRDVVA RAIHDEMAKS GAVYLDIRHL GEDFINHELP       300
     QERKLAQIYE GIDPVHELIP IKPSAHYSMG GIEVNEKCMT SVSALFAVGE CANHKTHGAN       360
     RLGGNSLLEL VVFGRECGKN AAEYGALHPA PVLENMQLAK DTNFVRGVMY FTNQIDFYQK       420
     QEMLANIFYN NVGLVRDDMG LKAVLGAIRQ MQKELPFMGP RDKSKVCNTN LVEFIEFGNK       480
     IELAEIIVVS AISRVESRGA HYRLDAPERN DRMFGAHTIT WKEDGVLCAD FIQ              533
//

If you have problems or comments...

PBIL Back to PBIL home page