(data stored in ACNUC7421 zone)

EMBL: CP002355.PE73

CP002355.PE73        Location/Qualifiers
FT   CDS             complement(73010..73267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0073"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR005829; KEGG: mbr:MONBRDRAFT_34030
FT                   hypothetical protein; SPTR: Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32741"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR0"
FT                   /protein_id="ADR32741.1"
FT                   /translation="MKKFFCVLLLVGFIGASANDALKAEVAAWLQGLDGGAQKAKYDSL
FT                   SPEKQAALDKFFEECRADVASGKSPKGTCKPLFLEKLKAL"
     MKKFFCVLLL VGFIGASAND ALKAEVAAWL QGLDGGAQKA KYDSLSPEKQ AALDKFFEEC        60
     RADVASGKSP KGTCKPLFLE KLKAL                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page