(data stored in ACNUC7421 zone)

EMBL: CP002355.PE74

CP002355.PE74        Location/Qualifiers
FT   CDS             73396..74301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0074"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="COGs: COG0679 permease; InterPro IPR004776; KEGG:
FT                   tdn:Suden_0341 auxin efflux carrier; PFAM: Auxin Efflux
FT                   Carrier; SPTR: Auxin Efflux Carrier; PFAM: Membrane
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32742"
FT                   /db_xref="GOA:E4TWR1"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR1"
FT                   /protein_id="ADR32742.1"
FT                   /translation="MQTLFSILGIYLFIAVGFGAKWAFKEKIDDRTITLLSVYFLQIFL
FT                   TFWGLLKRPIDTELLFAPSLYLAITLLALLLMIPLAKMLFHNPKERSIATVAALIGNTG
FT                   NLGIPLGIALFGEMSVPFLTLINLVNVFVVYTIGVFYYSRGEFSVRDSLLNILKLPVLW
FT                   AAMIAIALNLVGYVPSPAVDKTLMMGAYASMTMQLVLFGIYLYGIKLGEINLRLTAWVN
FT                   GTKFILIPLIAFGVLHYVDMEPVVKGILFLELIVPLAVANVNLASLYHCSPRTVTVEVF
FT                   TTSVVFLGIALILPTLLRMF"
     MQTLFSILGI YLFIAVGFGA KWAFKEKIDD RTITLLSVYF LQIFLTFWGL LKRPIDTELL        60
     FAPSLYLAIT LLALLLMIPL AKMLFHNPKE RSIATVAALI GNTGNLGIPL GIALFGEMSV       120
     PFLTLINLVN VFVVYTIGVF YYSRGEFSVR DSLLNILKLP VLWAAMIAIA LNLVGYVPSP       180
     AVDKTLMMGA YASMTMQLVL FGIYLYGIKL GEINLRLTAW VNGTKFILIP LIAFGVLHYV       240
     DMEPVVKGIL FLELIVPLAV ANVNLASLYH CSPRTVTVEV FTTSVVFLGI ALILPTLLRM       300
     F                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page