(data stored in ACNUC7421 zone)

EMBL: CP002355.PE75

CP002355.PE75        Location/Qualifiers
FT   CDS             complement(74279..75208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0075"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="COGs: COG1052 Lactate dehydrogenase and related
FT                   dehydrogenase; InterPro IPR006140: IPR006139; KEGG:
FT                   tdn:Suden_0034 2-hydroxyacid dehydrogenase; PFAM: D-isomer
FT                   specific 2-hydroxyacid dehydrogenase NAD-binding; D-isomer
FT                   specific 2-hydroxyacid dehydrogenase catalytic region;
FT                   SPTR: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding; PFAM: D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD binding domain; D-isomer specific
FT                   2-hydroxyacid dehydrogenase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32743"
FT                   /db_xref="GOA:E4TWR2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR2"
FT                   /protein_id="ADR32743.1"
FT                   /translation="MKIVILDALTYSDTSLEGFESLGDVAVYQTTFSDETTERVCDAEV
FT                   IVTNKVVINDAVMESAPNLKLICVAATGTNNIDHEAAKRRGIAVKNVAGYSTDAVVQHT
FT                   FSMLFYLMGHSRYYDEYVKSGAWQREAVFAHIGPSFSELRGKTWGIIGLGEIGRGVARV
FT                   AQAFGANVCYYSTSGKNDNGEYEKTTLSRLIENSDVISIHAPLNASTENLISHSELLQM
FT                   KDGAVLLNLGRGGIVDEDALSVIIDVKPIFVGLDVLAKEPMKTSHPLLSVKHPERLYIT
FT                   PHIAWTSREARERLIASTIENIKTFVKA"
     MKIVILDALT YSDTSLEGFE SLGDVAVYQT TFSDETTERV CDAEVIVTNK VVINDAVMES        60
     APNLKLICVA ATGTNNIDHE AAKRRGIAVK NVAGYSTDAV VQHTFSMLFY LMGHSRYYDE       120
     YVKSGAWQRE AVFAHIGPSF SELRGKTWGI IGLGEIGRGV ARVAQAFGAN VCYYSTSGKN       180
     DNGEYEKTTL SRLIENSDVI SIHAPLNAST ENLISHSELL QMKDGAVLLN LGRGGIVDED       240
     ALSVIIDVKP IFVGLDVLAK EPMKTSHPLL SVKHPERLYI TPHIAWTSRE ARERLIASTI       300
     ENIKTFVKA                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page