(data stored in ACNUC7421 zone)

EMBL: CP002355.PE76

CP002355.PE76        Location/Qualifiers
FT   CDS             complement(75343..76506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0076"
FT                   /product="formate-dependent phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /EC_number="6.3.4.-"
FT                   /note="COGs: COG0027 Formate-dependent
FT                   phosphoribosylglycinamide formyltransferase (GAR
FT                   transformylase); InterPro IPR005862: IPR011761: IPR003135;
FT                   KEGG: tdn:Suden_0033 phosphoribosylglycinamide
FT                   formyltransferase 2; PFAM: ATP-dependent carboxylate-amine
FT                   ligase domain protein ATP-grasp; SPTR:
FT                   Phosphoribosylglycinamide formyltransferase 2; TIGRFAM:
FT                   phosphoribosylglycinamide formyltransferase 2; PFAM:
FT                   ATP-grasp domain; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32744"
FT                   /db_xref="GOA:E4TWR3"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR3"
FT                   /protein_id="ADR32744.1"
FT                   /translation="MLFSAPLKNNSKKIMLLGSGELGKEVAIEAQRLGIEVIAVDRYNH
FT                   APAHLVANRSHVVNMQDKEAVLKLIRKEKPDYILPEIEAISIDALFAAEAEGFCVIPNA
FT                   EAVNKTMNRKNIRRFAAEDLGLKTSRYHFVSTYEDMCASAEDVGFPCVIKPVMSSSGHG
FT                   QSIARTREDLAASWEIAKEARGDASELIVEEFIRFDYEITLLTARNGVETVFCEPIGHI
FT                   QKDGDYIYSWQPMEMSKKALKRSQKIAKAITDGLGGKGLFGVELFVAGDEVYFSEVSPR
FT                   PHDTGMVTLITQSQSEFALHVRAVLGLPLGFTFYGDGASAAFKSVVESTEPVVDVADEV
FT                   FDDNSFVRVFGKPEAHVGRRMAVVLVFDKVNKAMKKAKKLIKKIKDA"
     MLFSAPLKNN SKKIMLLGSG ELGKEVAIEA QRLGIEVIAV DRYNHAPAHL VANRSHVVNM        60
     QDKEAVLKLI RKEKPDYILP EIEAISIDAL FAAEAEGFCV IPNAEAVNKT MNRKNIRRFA       120
     AEDLGLKTSR YHFVSTYEDM CASAEDVGFP CVIKPVMSSS GHGQSIARTR EDLAASWEIA       180
     KEARGDASEL IVEEFIRFDY EITLLTARNG VETVFCEPIG HIQKDGDYIY SWQPMEMSKK       240
     ALKRSQKIAK AITDGLGGKG LFGVELFVAG DEVYFSEVSP RPHDTGMVTL ITQSQSEFAL       300
     HVRAVLGLPL GFTFYGDGAS AAFKSVVEST EPVVDVADEV FDDNSFVRVF GKPEAHVGRR       360
     MAVVLVFDKV NKAMKKAKKL IKKIKDA                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page