(data stored in ACNUC7421 zone)

EMBL: CP002355.PE77

CP002355.PE77        Location/Qualifiers
FT   CDS             complement(76618..76830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0077"
FT                   /product="SSU ribosomal protein S21P"
FT                   /note="InterPro IPR018278: IPR001911; KEGG: tdn:Suden_0022
FT                   30S ribosomal protein S21; PFAM: ribosomal protein S21;
FT                   SPTR: 30S ribosomal protein S21; TIGRFAM: ribosomal protein
FT                   S21; PFAM: Ribosomal protein S21; TIGRFAM: ribosomal
FT                   protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32745"
FT                   /db_xref="GOA:E4TWR4"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR4"
FT                   /protein_id="ADR32745.1"
FT                   /translation="MPGIILRQDDNFDAAYRRFKKQTDRNLIVTEARARRNHVTETEKR
FT                   KQFKISARKKMLKRLYMMRRYESRL"
     MPGIILRQDD NFDAAYRRFK KQTDRNLIVT EARARRNHVT ETEKRKQFKI SARKKMLKRL        60
     YMMRRYESRL                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page