(data stored in ACNUC7421 zone)

EMBL: CP002355.PE78

CP002355.PE78        Location/Qualifiers
FT   CDS             76950..78614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0078"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004089; KEGG: cco:CCC13826_1039 protease HtpX;
FT                   PFAM: chemotaxis sensory transducer; SMART: chemotaxis
FT                   sensory transducer; SPTR: Methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: Methyl-accepting chemotaxis
FT                   protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32746"
FT                   /db_xref="GOA:E4TWR5"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR5"
FT                   /protein_id="ADR32746.1"
FT                   /translation="MHPRKTLMWLVFIGMMIPPVVWILLLAFSHLFSVDELISILFSIP
FT                   MALYMAVATSAMIFGFNHALIRIETLMKNPNRSEEAAAIVSKLPYWFLIGQLLYTSIGP
FT                   AVVLSGKSFISLERFGLAEAAVLPLLLLFIIPVFILFVIRLEEWVVSVPLSEKYPFVSF
FT                   GRKMVLAIFTTVLGNIILLVLLNTILLYSIPGLDLSTLLIKNSIVAVIGIVISAVNIAL
FT                   LVAQVTRPVKNLTDNLKTDLFNLTKSFSGFTRDETGSMMSCLNRFVGEIEHSISHAKEI
FT                   ASANLSSAQTLDTINTHIKSRVHESNSITQTTSDQAHSIQTIVNEGVENFTVTLENMNN
FT                   AVGLLHHGRQELSTLLDTISHSTELETELSSKLDQLNGEASQVQKILSVIGDIAEQTNL
FT                   LALNAAIEAARAGEHGRGFAVVSDEVRKLAERTQKSLTEINATINVIVQSIADATEQMH
FT                   LNAKAMQNLTMISQRVDKDINETVSAMENTNMLTKQSVTNSQTIANHINSMLVQMEKLG
FT                   TISSANDTSMRELSDIVSQIASSANALYTQLGQFKTH"
     MHPRKTLMWL VFIGMMIPPV VWILLLAFSH LFSVDELISI LFSIPMALYM AVATSAMIFG        60
     FNHALIRIET LMKNPNRSEE AAAIVSKLPY WFLIGQLLYT SIGPAVVLSG KSFISLERFG       120
     LAEAAVLPLL LLFIIPVFIL FVIRLEEWVV SVPLSEKYPF VSFGRKMVLA IFTTVLGNII       180
     LLVLLNTILL YSIPGLDLST LLIKNSIVAV IGIVISAVNI ALLVAQVTRP VKNLTDNLKT       240
     DLFNLTKSFS GFTRDETGSM MSCLNRFVGE IEHSISHAKE IASANLSSAQ TLDTINTHIK       300
     SRVHESNSIT QTTSDQAHSI QTIVNEGVEN FTVTLENMNN AVGLLHHGRQ ELSTLLDTIS       360
     HSTELETELS SKLDQLNGEA SQVQKILSVI GDIAEQTNLL ALNAAIEAAR AGEHGRGFAV       420
     VSDEVRKLAE RTQKSLTEIN ATINVIVQSI ADATEQMHLN AKAMQNLTMI SQRVDKDINE       480
     TVSAMENTNM LTKQSVTNSQ TIANHINSML VQMEKLGTIS SANDTSMREL SDIVSQIASS       540
     ANALYTQLGQ FKTH                                                         554
//

If you have problems or comments...

PBIL Back to PBIL home page