(data stored in ACNUC7421 zone)

EMBL: CP002355.PE79

CP002355.PE79        Location/Qualifiers
FT   CDS             78643..80286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0079"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="COGs: COG0358 DNA primase; InterProIPR006295:
FT                   IPR002694: IPR013264: IPR006171: IPR 006154; KEGG:
FT                   tdn:Suden_0023 DNA primase; PFAM: DNA primase catalytic
FT                   core domain; TOPRIM domain-containing protein; SMART:
FT                   Toprim sub domain-containing protein; SPTR: DNA primase;
FT                   TIGRFAM: DNA primase; PFAM: Toprim domain; DNA primase
FT                   catalytic core, N-terminal domain; CHC2 zinc finger;
FT                   DnaB-helicase binding domain of primase; TIGRFAM: DNA
FT                   primase, catalytic core"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32747"
FT                   /db_xref="GOA:E4TWR6"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR031988"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR6"
FT                   /protein_id="ADR32747.1"
FT                   /translation="MITQDSIEALKARLDIVDIVGSYIELKRAGSSFKAPCPFHDEKSP
FT                   SFVVNPSRQSYHCFGCGVHGDSIKFVMEFEKLNYPEAIEKLAASTNFTLHYTDNAQQKK
FT                   RSTLLESLNDWYQKLLEQNRTAQEYLHERGIYASSIERFGIGYAPTSPETLRFLEQRKL
FT                   PTAEAIEQGAIGRGDDGRLFARFIERITFPIHSTSGAIVGFGGRTITGHQAKYVNSSQS
FT                   AIFNKSRLLYAYHLAREAIYRRREIIVTEGYLDVVMLHQAGFTHAVATLGTALTAEHLP
FT                   LLRKGEPKVYVAYDGDKAGRAAAFKAAKLLSTSGFDGGVILFEGGLDPADMIKSGQIEQ
FT                   LNALLHRPIPFIEFVITEMISAYDLQDPKAKETALHENIAFLKTLSPLLQEEYRPFIAS
FT                   KLGISPSLIQIGQKKNTVPQPINFSHHDIWELSFIKTLLERPHIADTLLDFIDASLLQY
FT                   HVQEFESALQGRNDDPRLSALMMDDRIRTFEGDEGLRAELITFLSAHYNRELKKVTTQN
FT                   TVSFDQKSYLIRQYRDKIERLKRGELVPLG"
     MITQDSIEAL KARLDIVDIV GSYIELKRAG SSFKAPCPFH DEKSPSFVVN PSRQSYHCFG        60
     CGVHGDSIKF VMEFEKLNYP EAIEKLAAST NFTLHYTDNA QQKKRSTLLE SLNDWYQKLL       120
     EQNRTAQEYL HERGIYASSI ERFGIGYAPT SPETLRFLEQ RKLPTAEAIE QGAIGRGDDG       180
     RLFARFIERI TFPIHSTSGA IVGFGGRTIT GHQAKYVNSS QSAIFNKSRL LYAYHLAREA       240
     IYRRREIIVT EGYLDVVMLH QAGFTHAVAT LGTALTAEHL PLLRKGEPKV YVAYDGDKAG       300
     RAAAFKAAKL LSTSGFDGGV ILFEGGLDPA DMIKSGQIEQ LNALLHRPIP FIEFVITEMI       360
     SAYDLQDPKA KETALHENIA FLKTLSPLLQ EEYRPFIASK LGISPSLIQI GQKKNTVPQP       420
     INFSHHDIWE LSFIKTLLER PHIADTLLDF IDASLLQYHV QEFESALQGR NDDPRLSALM       480
     MDDRIRTFEG DEGLRAELIT FLSAHYNREL KKVTTQNTVS FDQKSYLIRQ YRDKIERLKR       540
     GELVPLG                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page