(data stored in ACNUC7421 zone)

EMBL: CP002355.PE8

CP002355.PE8         Location/Qualifiers
FT   CDS             complement(8677..9528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0008"
FT                   /product="phosphate ABC transporter membrane protein 1,
FT                   PhoT family"
FT                   /note="COGs: COG0573 ABC-type phosphate transport system
FT                   permease component; InterPro IPR011864: IPR000515; KEGG:
FT                   tdn:Suden_1885 phosphate ABC transporter permease; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Phosphate ABC transporter, permease
FT                   protein PstC; TIGRFAM: phosphate ABC transporter, inner
FT                   membrane subunit PstC; PFAM: Binding-protein-dependent
FT                   transport system inner membrane component; TIGRFAM:
FT                   phosphate ABC transporter, permease protein PstC; phosphate
FT                   ABC transporter, permease protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32676"
FT                   /db_xref="GOA:E4TW60"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW60"
FT                   /protein_id="ADR32676.1"
FT                   /translation="MIDKIFLNMTRTSALLILFIVAWIFVVLFNHSTEAMQTFGFDFIT
FT                   KDEWAPNLDKFGAYAAIFGSVASTFLAMLLAIPVAIGVAIFLSEIAHDKIKGFFGVSVE
FT                   LLAAIPSVIYGMWGLFFFVPILRDIFGGMGIGLLAAGIVLAIMILPFMAAVTRDAMNTT
FT                   PDILKESAYALGGTQWDVIKDVIIPYAKAGIIGSLILALGRAIGETMAVTFVMGNVHHT
FT                   PSSIMDPTTSIPVTLANEFTEADSSLYFSSLFGLALTLLIMSFVVIAIAKFYFLRKVRK
FT                   GQ"
     MIDKIFLNMT RTSALLILFI VAWIFVVLFN HSTEAMQTFG FDFITKDEWA PNLDKFGAYA        60
     AIFGSVASTF LAMLLAIPVA IGVAIFLSEI AHDKIKGFFG VSVELLAAIP SVIYGMWGLF       120
     FFVPILRDIF GGMGIGLLAA GIVLAIMILP FMAAVTRDAM NTTPDILKES AYALGGTQWD       180
     VIKDVIIPYA KAGIIGSLIL ALGRAIGETM AVTFVMGNVH HTPSSIMDPT TSIPVTLANE       240
     FTEADSSLYF SSLFGLALTL LIMSFVVIAI AKFYFLRKVR KGQ                         283
//

If you have problems or comments...

PBIL Back to PBIL home page