(data stored in ACNUC7421 zone)

EMBL: CP002355.PE80

CP002355.PE80        Location/Qualifiers
FT   CDS             80435..81406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0080"
FT                   /product="Queuosine synthesis"
FT                   /note="COGs: COG0482
FT                   tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase
FT                   contains the PP-loop ATPase domain; InterPro IPR018317;
FT                   KEGG: tdn:Suden_0026 thiamine biosynthesis protein:ExsB;
FT                   PFAM: Queuosine synthesis-like; SPTR: Thiamine biosynthesis
FT                   protein:ExsB; PFAM: Thiamine biosynthesis protein (ThiI)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32748"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR7"
FT                   /protein_id="ADR32748.1"
FT                   /translation="MKAIALFSGGLDSTLAAKLIIDQGIEVIACNINTGFGSTKDRLAH
FT                   MKNMCEQIGAEFRSVDIRDEYIREVLFTPKYGYGKNFNPCIDCHAKMFEVAKRVMEEWG
FT                   ASFLISGEVLGQRPMSQNSESLQKVLNLSNCEGLLLRPLSAKALTPTIPETEGWVDREK
FT                   LENINGRNRERQMELAEQFGLKDYEAPGGGCLLTDENFSNKIRDFIAHDTFSVEDIPTL
FT                   KYGRQLRLPEGAKLIIGRNAEDNAVLEAIENSKFIHIRTELVGPHAMLSRTATDNDKTL
FT                   AAKLVLAYCKAGFEGEQTLMFGDEELTAVSDLSRNDAQKYFI"
     MKAIALFSGG LDSTLAAKLI IDQGIEVIAC NINTGFGSTK DRLAHMKNMC EQIGAEFRSV        60
     DIRDEYIREV LFTPKYGYGK NFNPCIDCHA KMFEVAKRVM EEWGASFLIS GEVLGQRPMS       120
     QNSESLQKVL NLSNCEGLLL RPLSAKALTP TIPETEGWVD REKLENINGR NRERQMELAE       180
     QFGLKDYEAP GGGCLLTDEN FSNKIRDFIA HDTFSVEDIP TLKYGRQLRL PEGAKLIIGR       240
     NAEDNAVLEA IENSKFIHIR TELVGPHAML SRTATDNDKT LAAKLVLAYC KAGFEGEQTL       300
     MFGDEELTAV SDLSRNDAQK YFI                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page