(data stored in ACNUC7421 zone)

EMBL: CP002355.PE81

CP002355.PE81        Location/Qualifiers
FT   CDS             complement(81525..81788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0081"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="InterPro IPR017969: IPR006121; KEGG: bam:Bamb_4827
FT                   heavy metal translocating P-type ATPase; PFAM: Heavy metal
FT                   transport/detoxification protein; SPTR: Cation transport
FT                   ATPase; PFAM: Heavy-metal-associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32749"
FT                   /db_xref="GOA:E4TWR8"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR8"
FT                   /protein_id="ADR32749.1"
FT                   /translation="MKKVLLTLCALVAVASADQLVNLKIDGMMCPACVKNVKGSLADVK
FT                   GVKESTVYLKEGKAEVKAADSTKADSLCDAVKKAGYGCTVTK"
     MKKVLLTLCA LVAVASADQL VNLKIDGMMC PACVKNVKGS LADVKGVKES TVYLKEGKAE        60
     VKAADSTKAD SLCDAVKKAG YGCTVTK                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page