(data stored in ACNUC7421 zone)

EMBL: CP002355.PE82

CP002355.PE82        Location/Qualifiers
FT   CDS             81912..82601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0082"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG2836 conserved hypothetical protein; KEGG:
FT                   sdl:Sdel_1922 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32750"
FT                   /db_xref="GOA:E4TWR9"
FT                   /db_xref="InterPro:IPR039447"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR9"
FT                   /protein_id="ADR32750.1"
FT                   /translation="MHGIEWWLIISIAFAGSFGHCIGMCGGFIVAYSSTKIDATMSRSA
FT                   QLIRHSAYNIGRVSSYVLLGMIFGTIGSLFALSMEMHGALFIFAGIIMIVTALGMFGLS
FT                   KLIHVLERGFSSNPLFKTLFSRLIKSKSIGSFFALGVMNGFFPCGFVFFFAAKAAASAS
FT                   IIDGGLIMAAFGLATVPTLLALGQSVSFFKEIAFRQTMNRIAALAILIYGLYSVYYGLA
FT                   YFFNLPI"
     MHGIEWWLII SIAFAGSFGH CIGMCGGFIV AYSSTKIDAT MSRSAQLIRH SAYNIGRVSS        60
     YVLLGMIFGT IGSLFALSME MHGALFIFAG IIMIVTALGM FGLSKLIHVL ERGFSSNPLF       120
     KTLFSRLIKS KSIGSFFALG VMNGFFPCGF VFFFAAKAAA SASIIDGGLI MAAFGLATVP       180
     TLLALGQSVS FFKEIAFRQT MNRIAALAIL IYGLYSVYYG LAYFFNLPI                   229
//

If you have problems or comments...

PBIL Back to PBIL home page