(data stored in ACNUC7421 zone)

EMBL: CP002355.PE83

CP002355.PE83        Location/Qualifiers
FT   CDS             complement(82615..83406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0083"
FT                   /product="putative signal transduction protein"
FT                   /note="COGs: COG1639 signal transduction protein; InterPro
FT                   IPR013976; KEGG: sdl:Sdel_0866 metal-dependent hydrolase
FT                   HDOD; PFAM: Metal-dependent hydrolase HDOD; SPTR:
FT                   Thiamine-phosphate kinase; PFAM: HDOD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32751"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS0"
FT                   /protein_id="ADR32751.1"
FT                   /translation="MLEEIKSLPPLPISVVRIQEICMSNDTDIDELSRVIEHDPMLSAN
FT                   ILKSVNSPLYGMSKEISSVHQAVMLFGISMIRGFAAASAIKKSIIIDLSSYSVTIDDLT
FT                   KVSALQTALAREWYRNVDKSMLPLLQSSAFLMELGKLVASLKIISSGNLADFISDIAEG
FT                   KSVEETERKYLESSSYEIAAIMFEHWNFEPALIDALREITDPSTQNPYSRALRAITQAV
FT                   NFQEIFSEQSLSAALATIEEFGLNKDAFEEAVLTVKAAQKE"
     MLEEIKSLPP LPISVVRIQE ICMSNDTDID ELSRVIEHDP MLSANILKSV NSPLYGMSKE        60
     ISSVHQAVML FGISMIRGFA AASAIKKSII IDLSSYSVTI DDLTKVSALQ TALAREWYRN       120
     VDKSMLPLLQ SSAFLMELGK LVASLKIISS GNLADFISDI AEGKSVEETE RKYLESSSYE       180
     IAAIMFEHWN FEPALIDALR EITDPSTQNP YSRALRAITQ AVNFQEIFSE QSLSAALATI       240
     EEFGLNKDAF EEAVLTVKAA QKE                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page