(data stored in ACNUC7421 zone)

EMBL: CP002355.PE84

CP002355.PE84        Location/Qualifiers
FT   CDS             83545..83970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0084"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0027 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32752"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS1"
FT                   /protein_id="ADR32752.1"
FT                   /translation="MAGVMFSFYNFASLLDLNIGLSDRLDENRSESFTLLYCDFSNIPK
FT                   TLVESNLQSLLRTSDSIVHWEHYYFFVMPYTDRYGCGIVKKMIEEIFDRPIPSAAVCYP
FT                   VDGENPAELFEALHAEAKKLLNIDLDCLYSAENREVW"
     MAGVMFSFYN FASLLDLNIG LSDRLDENRS ESFTLLYCDF SNIPKTLVES NLQSLLRTSD        60
     SIVHWEHYYF FVMPYTDRYG CGIVKKMIEE IFDRPIPSAA VCYPVDGENP AELFEALHAE       120
     AKKLLNIDLD CLYSAENREV W                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page