(data stored in ACNUC7421 zone)

EMBL: CP002355.PE85

CP002355.PE85        Location/Qualifiers
FT   CDS             complement(83975..84598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0085"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cnb:CNBN0060 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32753"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS2"
FT                   /protein_id="ADR32753.1"
FT                   /translation="MKKLALIMMFSVTSVVLNAEEYTIQTISTLKESSITPAFEKKVEK
FT                   TSLHATKKKEGECNIVTVGSYKSVKEAHVDLKKAKVIAKDAFIRPIARTTPKVCETHTA
FT                   TAKVPSKEKKGEKAVSSVQAITATKEEAIAAVHEAVTPSTVATADAHTGTIMPSQTTKE
FT                   IQTPNNSPVFVYDRNLARKSDIQEAIEYYKRSPYYSFKPVLSLR"
     MKKLALIMMF SVTSVVLNAE EYTIQTISTL KESSITPAFE KKVEKTSLHA TKKKEGECNI        60
     VTVGSYKSVK EAHVDLKKAK VIAKDAFIRP IARTTPKVCE THTATAKVPS KEKKGEKAVS       120
     SVQAITATKE EAIAAVHEAV TPSTVATADA HTGTIMPSQT TKEIQTPNNS PVFVYDRNLA       180
     RKSDIQEAIE YYKRSPYYSF KPVLSLR                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page