(data stored in ACNUC7421 zone)

EMBL: CP002355.PE87

CP002355.PE87        Location/Qualifiers
FT   CDS             85403..86092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0087"
FT                   /product="TonB family protein"
FT                   /note="InterPro IPR006260: IPR003538; KEGG:
FT                   cco:CCC13826_0392 ATP-binding protein; SPTR: Protein TonB;
FT                   TIGRFAM: TonB family protein; PFAM: Gram-negative bacterial
FT                   tonB protein; TIGRFAM: TonB family C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32755"
FT                   /db_xref="GOA:E4TWS4"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS4"
FT                   /protein_id="ADR32755.1"
FT                   /translation="MRSANSFFISVGIHLSLAALMIGTLSAVRKNTPAAEEKMVLNLLT
FT                   QTPAPKFPEPVAKPQPPVQPKVPLPAVKPPEARPVPQPKKTVTEQSKPFMNTPVQTAPL
FT                   APNVSSVPPARVTEQPIQPQAIKAVPPAQKQQERYEEENLGRIRSILMERLTYPKNALR
FT                   LKQEGEATVTFTFEPDREVSQISITKSSGFDLLDEAAKNLIISSASEFPKPSKTVRISV
FT                   PIAYKLR"
     MRSANSFFIS VGIHLSLAAL MIGTLSAVRK NTPAAEEKMV LNLLTQTPAP KFPEPVAKPQ        60
     PPVQPKVPLP AVKPPEARPV PQPKKTVTEQ SKPFMNTPVQ TAPLAPNVSS VPPARVTEQP       120
     IQPQAIKAVP PAQKQQERYE EENLGRIRSI LMERLTYPKN ALRLKQEGEA TVTFTFEPDR       180
     EVSQISITKS SGFDLLDEAA KNLIISSASE FPKPSKTVRI SVPIAYKLR                   229
//

If you have problems or comments...

PBIL Back to PBIL home page