(data stored in ACNUC7421 zone)

EMBL: CP002355.PE89

CP002355.PE89        Location/Qualifiers
FT   CDS             86637..87887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0089"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG3174 membrane protein; KEGG: sun:SUN_2184
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: MgtC family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32757"
FT                   /db_xref="GOA:E4TWS6"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS6"
FT                   /protein_id="ADR32757.1"
FT                   /translation="MDSLFIQNSILSLVLGFLIGLQREMHTIYLHKAKDFGGARTFSMI
FT                   AFFGYLSAWFSAFIPYFFLIAAGLSGLLLIAAYIVNSLSASEKGTTTEFTALVTFVIGA
FT                   MLHFTLPLLAAFITMIVLFVLNLKEKIQEYEKTITKQDLSAAILFMLMTFVILPILPDR
FT                   AIDPMGLINLYRIWIMVVLVAGISFFGYIAIRILGSTHGISAAGLFGGLVSSTAVAMSM
FT                   ARRVHENGFLAKNLAMGIALASSVMLLRAGIEIWVINPALVQTFIIPIAIGTLAGYGYI
FT                   AMLYFTSKRENISQNIEFKNPFDLKEALVMGLVFGATLALISLSNRYIGDMGVYAVALV
FT                   SGIADVDAIILSLSSLAKNGLNPSTAHHAILIAIISNTFAKAALVLFFGKIGLFRLVIT
FT                   YYLISIGAFALTALLMY"
     MDSLFIQNSI LSLVLGFLIG LQREMHTIYL HKAKDFGGAR TFSMIAFFGY LSAWFSAFIP        60
     YFFLIAAGLS GLLLIAAYIV NSLSASEKGT TTEFTALVTF VIGAMLHFTL PLLAAFITMI       120
     VLFVLNLKEK IQEYEKTITK QDLSAAILFM LMTFVILPIL PDRAIDPMGL INLYRIWIMV       180
     VLVAGISFFG YIAIRILGST HGISAAGLFG GLVSSTAVAM SMARRVHENG FLAKNLAMGI       240
     ALASSVMLLR AGIEIWVINP ALVQTFIIPI AIGTLAGYGY IAMLYFTSKR ENISQNIEFK       300
     NPFDLKEALV MGLVFGATLA LISLSNRYIG DMGVYAVALV SGIADVDAII LSLSSLAKNG       360
     LNPSTAHHAI LIAIISNTFA KAALVLFFGK IGLFRLVITY YLISIGAFAL TALLMY           416
//

If you have problems or comments...

PBIL Back to PBIL home page