(data stored in ACNUC7421 zone)

EMBL: CP002355.PE9

CP002355.PE9         Location/Qualifiers
FT   CDS             complement(9652..11040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0009"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /note="COGs: COG0617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase; InterPro IPR006675: IPR002646: IPR006674; KEGG:
FT                   ant:Arnit_0649 polynucleotide adenylyltransferase region;
FT                   PFAM: Polynucleotide adenylyltransferase region;
FT                   metal-dependent phosphohydrolase HD sub domain; SPTR:
FT                   Polynucleotide adenylyltransferase region; TIGRFAM: metal
FT                   dependent phophohydrolase; PFAM: HD domain; Poly A
FT                   polymerase head domain; TIGRFAM: uncharacterized domain
FT                   HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32677"
FT                   /db_xref="GOA:E4TW61"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW61"
FT                   /protein_id="ADR32677.1"
FT                   /translation="MIPLFPPLVRLVEHLSHHGIKPIFVGGFVRDFFTGHTTSDLDIEL
FT                   YGVTSLETLEALLRPFGKLGLYGKSFGVLKLNYEGYSIDFSPPRTESKSGFGHKGFELE
FT                   WFSDLDFSAAARRRDFTINAIGYDPLTQTLLDPFGGVEDLKAKRLRCVDPETFIDDPLR
FT                   VLRAVQFTARFELTCDKNLLALCRQMIANGALNELPKERIFEEFKKLLLQSNRPSIGMA
FT                   LLRDMGALGFFTPLDRLEETPQEKDSHPEGSVWVHTLMALDSMASLRCGEWRDDIILML
FT                   AVLLHDIGKPDTTLYADGILNAPKHAEIGAEMAQDWLERVTEDKTLISRILPLIRYHGW
FT                   PRKLYRSNALDSDILRLSTYVCIRDLILVAKADFFGRAFVGNIPEHFEAGEWLYERASA
FT                   LGVLVEPPVPLLMGRDLIALGMPPSEAFKSILNDAYDAQLNQLFFTRDQALEWLNIYLE
FT                   RGKL"
     MIPLFPPLVR LVEHLSHHGI KPIFVGGFVR DFFTGHTTSD LDIELYGVTS LETLEALLRP        60
     FGKLGLYGKS FGVLKLNYEG YSIDFSPPRT ESKSGFGHKG FELEWFSDLD FSAAARRRDF       120
     TINAIGYDPL TQTLLDPFGG VEDLKAKRLR CVDPETFIDD PLRVLRAVQF TARFELTCDK       180
     NLLALCRQMI ANGALNELPK ERIFEEFKKL LLQSNRPSIG MALLRDMGAL GFFTPLDRLE       240
     ETPQEKDSHP EGSVWVHTLM ALDSMASLRC GEWRDDIILM LAVLLHDIGK PDTTLYADGI       300
     LNAPKHAEIG AEMAQDWLER VTEDKTLISR ILPLIRYHGW PRKLYRSNAL DSDILRLSTY       360
     VCIRDLILVA KADFFGRAFV GNIPEHFEAG EWLYERASAL GVLVEPPVPL LMGRDLIALG       420
     MPPSEAFKSI LNDAYDAQLN QLFFTRDQAL EWLNIYLERG KL                          462
//

If you have problems or comments...

PBIL Back to PBIL home page