(data stored in ACNUC7421 zone)

EMBL: CP002355.PE90

CP002355.PE90        Location/Qualifiers
FT   CDS             87996..88925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_0927 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32758"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS7"
FT                   /protein_id="ADR32758.1"
FT                   /translation="MKVATHSLSLGAVSLHYRGEEEKLSLASSVQTFQKIEDGMGTAED
FT                   PLAEVDPKLRIMALLLEALTGQKISLTAFHSNSNVSDTANTASVSRENSPILEYQYHKE
FT                   ELNSMNFSAEGKVLLEDGSMKTFSLSIKWEQSFSESLRLRIQDGKILTDPLVISLDGTQ
FT                   PLSSNAFAFNLNGESEQSLPYLTGRAGYLAYDADQDGKITSGSELFGPKSGKGFMELSA
FT                   YDEDKNGWIDGNDSFFKQLRVWTITEGSESLLSLEEVGIGAISLQTTNVDFTLKRDIDD
FT                   PIAHYKKASVAVGENGEAYGIFEIDVAV"
     MKVATHSLSL GAVSLHYRGE EEKLSLASSV QTFQKIEDGM GTAEDPLAEV DPKLRIMALL        60
     LEALTGQKIS LTAFHSNSNV SDTANTASVS RENSPILEYQ YHKEELNSMN FSAEGKVLLE       120
     DGSMKTFSLS IKWEQSFSES LRLRIQDGKI LTDPLVISLD GTQPLSSNAF AFNLNGESEQ       180
     SLPYLTGRAG YLAYDADQDG KITSGSELFG PKSGKGFMEL SAYDEDKNGW IDGNDSFFKQ       240
     LRVWTITEGS ESLLSLEEVG IGAISLQTTN VDFTLKRDID DPIAHYKKAS VAVGENGEAY       300
     GIFEIDVAV                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page