(data stored in ACNUC7421 zone)

EMBL: CP002355.PE91

CP002355.PE91        Location/Qualifiers
FT   CDS             complement(88955..89575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0091"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="InterPro IPR000326; KEGG: cli:Clim_0637
FT                   phosphoesterase PA-phosphatase related; PFAM:
FT                   phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; SPTR:
FT                   Phosphoesterase PA-phosphatase related; PFAM: PAP2
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32759"
FT                   /db_xref="GOA:E4TWS8"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS8"
FT                   /protein_id="ADR32759.1"
FT                   /translation="MSENTSMIRTSLIVFLCAAFSFFYIDQVLALYFHNFHNSWVIAIF
FT                   NYITKLGDSLYSLALLSILFLLYRRQKPLFSQKMLYLFATVVLSGLIVDVIKIIVSRLR
FT                   PNMLFEHDMYGFVWFKLGYEFNSLPSGHSATAFALSIGLSLLFPRYKYLYILIGLLVVM
FT                   SRVILTCHYLSDILLGSLFGWLTALIIYRKYFTRSLIQCPAMS"
     MSENTSMIRT SLIVFLCAAF SFFYIDQVLA LYFHNFHNSW VIAIFNYITK LGDSLYSLAL        60
     LSILFLLYRR QKPLFSQKML YLFATVVLSG LIVDVIKIIV SRLRPNMLFE HDMYGFVWFK       120
     LGYEFNSLPS GHSATAFALS IGLSLLFPRY KYLYILIGLL VVMSRVILTC HYLSDILLGS       180
     LFGWLTALII YRKYFTRSLI QCPAMS                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page