(data stored in ACNUC7421 zone)

EMBL: CP002355.PE92

CP002355.PE92        Location/Qualifiers
FT   CDS             89927..91456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0092"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro IPR000160;
FT                   KEGG: aeh:Mlg_2451 periplasmic sensor diguanylate
FT                   cyclase/phosphodiesterase; PFAM: GGDEF domain containing
FT                   protein; SMART: GGDEF domain containing protein; SPTR:
FT                   Diguanylate cyclase; TIGRFAM: diguanylate cyclase; PFAM:
FT                   GGDEF domain; Bacterial extracellular solute-binding
FT                   proteins, family 3; TIGRFAM: diguanylate cyclase (GGDEF)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32760"
FT                   /db_xref="GOA:E4TWS9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS9"
FT                   /protein_id="ADR32760.1"
FT                   /translation="MHLIFILLIATNLFSANSLTFGVFAYHSPSKIIKEYQPVVDHLSK
FT                   ELNTTITLKILSQQDLEKQVSQDKIDIIATNPTHFLALHAKGHVTGAMVTEVKKYDKFL
FT                   TPYLGGVIITRSDRHDIRTLQDLKGKVIAIPGKKFLGGFQTQNYEFEKLGINLNKYSVL
FT                   HKESNHNEVVKSVINGKADAGFVRTGIIEEMNIDKQLDKSKLFIINERHYHYFPLKIST
FT                   ELYPEWAIATSMHLPVPTVQKIVLALYSYKAKSNGRGVIEGFTIPADYANIDSLARVLR
FT                   LPPYEKAPHFTFVDVWDKYKFWIILLTISSTTIFILLIIVYRINRKLNQTSAELFDLAT
FT                   HDPLTGLFNRRGMMERLKFLLAELGRNKKNGALIYLDLDNFKPLNDSYGHAIGDELLIQ
FT                   VSKRIGMTVRAIDTIARMGGDEFLVILSHMEPTKVYEDAKQIAEKLRTVLNEPFSISIN
FT                   EELEIKHSISASIGMVIFDEHHKADTIIIHADAAMYEAKEQGRNRVVVGKC"
     MHLIFILLIA TNLFSANSLT FGVFAYHSPS KIIKEYQPVV DHLSKELNTT ITLKILSQQD        60
     LEKQVSQDKI DIIATNPTHF LALHAKGHVT GAMVTEVKKY DKFLTPYLGG VIITRSDRHD       120
     IRTLQDLKGK VIAIPGKKFL GGFQTQNYEF EKLGINLNKY SVLHKESNHN EVVKSVINGK       180
     ADAGFVRTGI IEEMNIDKQL DKSKLFIINE RHYHYFPLKI STELYPEWAI ATSMHLPVPT       240
     VQKIVLALYS YKAKSNGRGV IEGFTIPADY ANIDSLARVL RLPPYEKAPH FTFVDVWDKY       300
     KFWIILLTIS STTIFILLII VYRINRKLNQ TSAELFDLAT HDPLTGLFNR RGMMERLKFL       360
     LAELGRNKKN GALIYLDLDN FKPLNDSYGH AIGDELLIQV SKRIGMTVRA IDTIARMGGD       420
     EFLVILSHME PTKVYEDAKQ IAEKLRTVLN EPFSISINEE LEIKHSISAS IGMVIFDEHH       480
     KADTIIIHAD AAMYEAKEQG RNRVVVGKC                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page