(data stored in ACNUC7421 zone)

EMBL: CP002355.PE93

CP002355.PE93        Location/Qualifiers
FT   CDS             92050..93462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ant:Arnit_0995 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32761"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT0"
FT                   /protein_id="ADR32761.1"
FT                   /translation="MNTSINAPLGTEQEELNGVASIEVYNFPTASGIDSAYYFIESNAD
FT                   YKEFFHYSIFSVVESAKESNGGYVPKDSLTITISDIAFIYLGKDQGFYFFADRAGAFRV
FT                   GFKDPDTNQGVHDIRVQLQGIGIYALGLRFLADYINGTILKEISKPNYYITRADLNIFC
FT                   QYDLGNIIEPEHIVTRKRKFERIIGKKKGYETLYIGKPPARLRVYNKALEIDHTSMKTH
FT                   FLKSYLEPLGINVLEPFWNFEFECHRDFLKQYKINTLDDLLGNAEMLFHKMMEQIRLVD
FT                   TATITLKDIEANRLYKAPTHPLWNYLDQAYTFNAIDQKKIPLERIVYAPKELNANDFIE
FT                   EFRLLTQKYAEHSVIVNYEELRDVLHESRLWLTKKAQKVIKPFVPIELQTDQRKYLLTR
FT                   NHTAVAILPKSLEYISDTELITLESLLIKALHQELSYQDQDISLIVKHTQAVNEEKERR
FT                   RAGQKELELWQV"
     MNTSINAPLG TEQEELNGVA SIEVYNFPTA SGIDSAYYFI ESNADYKEFF HYSIFSVVES        60
     AKESNGGYVP KDSLTITISD IAFIYLGKDQ GFYFFADRAG AFRVGFKDPD TNQGVHDIRV       120
     QLQGIGIYAL GLRFLADYIN GTILKEISKP NYYITRADLN IFCQYDLGNI IEPEHIVTRK       180
     RKFERIIGKK KGYETLYIGK PPARLRVYNK ALEIDHTSMK THFLKSYLEP LGINVLEPFW       240
     NFEFECHRDF LKQYKINTLD DLLGNAEMLF HKMMEQIRLV DTATITLKDI EANRLYKAPT       300
     HPLWNYLDQA YTFNAIDQKK IPLERIVYAP KELNANDFIE EFRLLTQKYA EHSVIVNYEE       360
     LRDVLHESRL WLTKKAQKVI KPFVPIELQT DQRKYLLTRN HTAVAILPKS LEYISDTELI       420
     TLESLLIKAL HQELSYQDQD ISLIVKHTQA VNEEKERRRA GQKELELWQV                  470
//

If you have problems or comments...

PBIL Back to PBIL home page