(data stored in ACNUC7421 zone)

EMBL: CP002355.PE94

CP002355.PE94        Location/Qualifiers
FT   CDS             93450..93887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0094"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdl:Sdel_1996 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32762"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT1"
FT                   /protein_id="ADR32762.1"
FT                   /translation="MASIELITKEDFDELKALIIGAVRPLMTVEEAGEYLRLSPHTIRH
FT                   KIADQTFILGVHYSDKAGKILFAKERLDTWLWEESKESNNVSIQKKQSGVDRLIRQWSE
FT                   SQEIHGTGVDCKQRQKGRKRPHSPIKNGDNDGAGNTQKRAS"
     MASIELITKE DFDELKALII GAVRPLMTVE EAGEYLRLSP HTIRHKIADQ TFILGVHYSD        60
     KAGKILFAKE RLDTWLWEES KESNNVSIQK KQSGVDRLIR QWSESQEIHG TGVDCKQRQK       120
     GRKRPHSPIK NGDNDGAGNT QKRAS                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page