(data stored in ACNUC7421 zone)

EMBL: CP002355.PE95

CP002355.PE95        Location/Qualifiers
FT   CDS             93892..94785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0095"
FT                   /product="integrase family protein"
FT                   /note="InterPro IPR002104; KEGG: sdl:Sdel_1112 integrase
FT                   family protein; PFAM: integrase family protein; SPTR:
FT                   Integrase family protein; manually curated; PFAM: Phage
FT                   integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32763"
FT                   /db_xref="GOA:E4TWT2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT2"
FT                   /protein_id="ADR32763.1"
FT                   /translation="MSYYADLFMDSKRQTTVPRTHERYLSIIKHSILPVFGDSPIRELK
FT                   VSNVEKWRNDLLKRFTAKTVKEYQIVLRGIFQKALHDEEIGKNPIDALDSLKVKKPHVV
FT                   PFMPYEVKLILDTAQGWFKNYLALGFMTGMRVGEIVALKWENVNLKKREIYVCASRIEG
FT                   VEGTTKTQSSIRYIPIIDTLVPFLEAQKKLSGDKEYVFVNQYGEVFYDYKTIGANQWKS
FT                   ILKECKLDHRRMYEMRHTCATNLLMSGQYSVNEIASILGHTTPQMLFERYTRNISAERK
FT                   PFNKTIDIYGVAGMAL"
     MSYYADLFMD SKRQTTVPRT HERYLSIIKH SILPVFGDSP IRELKVSNVE KWRNDLLKRF        60
     TAKTVKEYQI VLRGIFQKAL HDEEIGKNPI DALDSLKVKK PHVVPFMPYE VKLILDTAQG       120
     WFKNYLALGF MTGMRVGEIV ALKWENVNLK KREIYVCASR IEGVEGTTKT QSSIRYIPII       180
     DTLVPFLEAQ KKLSGDKEYV FVNQYGEVFY DYKTIGANQW KSILKECKLD HRRMYEMRHT       240
     CATNLLMSGQ YSVNEIASIL GHTTPQMLFE RYTRNISAER KPFNKTIDIY GVAGMAL          297
//

If you have problems or comments...

PBIL Back to PBIL home page