(data stored in ACNUC7421 zone)

EMBL: CP002355.PE96

CP002355.PE96        Location/Qualifiers
FT   CDS             95155..96255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0096"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /note="COGs: COG0232 dGTP triphosphohydrolase; InterPro
FT                   IPR006261: IPR006674: IPR003607; KEGG: tdn:Suden_0021
FT                   deoxyguanosinetriphosphate triphosphohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region; SPTR:
FT                   Deoxyguanosinetriphosphate triphosphohydrolase; TIGRFAM:
FT                   deoxyguanosinetriphosphate triphosphohydrolase; PFAM: HD
FT                   domain; TIGRFAM: deoxyguanosinetriphosphate
FT                   triphosphohydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32764"
FT                   /db_xref="GOA:E4TWT3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT3"
FT                   /protein_id="ADR32764.1"
FT                   /translation="MLPNQRFHPISDDFRSPYARDRDRIIHSGSFRRLEYKTQVFLNSQ
FT                   GDFFRTRLTHSIEVSQIARSIASHLGLEESLAESIALSHDLGHTPFGHIGGDTLDECLK
FT                   ERGFVSGFEHNFQSFRVVTKLEQRYKAFLGLNLTYATLEGIIKHSYPYNKTFLPNAIRE
FT                   VFALDTHPSIEAMVVDRADEIAYISHDIDDGVASGLITFETLKSSELIQTILQKVYAEG
FT                   IHEDEDEMFRYRFSSHLINHLVYSLLEYSHDKVDNSRVLASAIPATEEIPIGFEPELET
FT                   QIKKLKKILFQELYQHKQIMRKMFSGKQAIIGLFNALMEEPKMLPHYYLEQCERRNKHR
FT                   IISDYIASMSDRYAMKLYNELYGREG"
     MLPNQRFHPI SDDFRSPYAR DRDRIIHSGS FRRLEYKTQV FLNSQGDFFR TRLTHSIEVS        60
     QIARSIASHL GLEESLAESI ALSHDLGHTP FGHIGGDTLD ECLKERGFVS GFEHNFQSFR       120
     VVTKLEQRYK AFLGLNLTYA TLEGIIKHSY PYNKTFLPNA IREVFALDTH PSIEAMVVDR       180
     ADEIAYISHD IDDGVASGLI TFETLKSSEL IQTILQKVYA EGIHEDEDEM FRYRFSSHLI       240
     NHLVYSLLEY SHDKVDNSRV LASAIPATEE IPIGFEPELE TQIKKLKKIL FQELYQHKQI       300
     MRKMFSGKQA IIGLFNALME EPKMLPHYYL EQCERRNKHR IISDYIASMS DRYAMKLYNE       360
     LYGREG                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page