(data stored in ACNUC7421 zone)

EMBL: CP002355.PE98

CP002355.PE98        Location/Qualifiers
FT   CDS             complement(96807..97802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0098"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="COGs: COG0150 Phosphoribosylaminoimidazole (AIR)
FT                   synthetase; InterPro IPR004733: IPR000728: IPR010918; KEGG:
FT                   tdn:Suden_2050 phosphoribosylaminoimidazole synthetase;
FT                   PFAM: AIR synthase related protein domain protein; AIR
FT                   synthase related protein; PRIAM:
FT                   Phosphoribosylformylglycinamidine cyclo-ligase; SPTR:
FT                   Phosphoribosylformylglycinamidine cyclo-ligase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine cyclo-ligase; PFAM: AIR
FT                   synthase related protein, N-terminal domain; AIR synthase
FT                   related protein, C-terminal domain; TIGRFAM:
FT                   phosphoribosylaminoimidazole synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32766"
FT                   /db_xref="GOA:E4TWT5"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT5"
FT                   /protein_id="ADR32766.1"
FT                   /translation="MSQISYKDAGVDIDAGNSFVENIKPLVKSTAIPGVLGGIGSFAGA
FT                   FELPSGYREPVMLAATDGVGTKLKLAIDSGIHNTVGIDLVAMCVNDLICNFGTPSFFLD
FT                   YYATGKLDVTAATAVVSGIAEGCRQAECALIGGETAEMPGMYHSDDYDLAGFAVGIGEK
FT                   SELDRSDKVQAGDILIALPSSGLHSNGFSLARKVLFEKMGMKFEDEFEGKPLIETLLTP
FT                   TRIYVKTFKALKNKIQALAHITGGGIVENFPRVLPEGLRAVITESSIRVLPIFELIGQH
FT                   VERAEMFRAFNMGVGMILVVKEADVADVLAATDGYVIGHLEEGKREAVLV"
     MSQISYKDAG VDIDAGNSFV ENIKPLVKST AIPGVLGGIG SFAGAFELPS GYREPVMLAA        60
     TDGVGTKLKL AIDSGIHNTV GIDLVAMCVN DLICNFGTPS FFLDYYATGK LDVTAATAVV       120
     SGIAEGCRQA ECALIGGETA EMPGMYHSDD YDLAGFAVGI GEKSELDRSD KVQAGDILIA       180
     LPSSGLHSNG FSLARKVLFE KMGMKFEDEF EGKPLIETLL TPTRIYVKTF KALKNKIQAL       240
     AHITGGGIVE NFPRVLPEGL RAVITESSIR VLPIFELIGQ HVERAEMFRA FNMGVGMILV       300
     VKEADVADVL AATDGYVIGH LEEGKREAVL V                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page