(data stored in SCRATCH zone)

EMBL: CP002399.PE115

CP002399.PE115       Location/Qualifiers
FT   CDS             114517..115149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0115"
FT                   /product="rare lipoprotein A"
FT                   /note="KEGG: saq:Sare_0084 rare lipoprotein A; TIGRFAM:
FT                   rare lipoprotein A; PFAM: Rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05669"
FT                   /inference="protein motif:TFAM:TIGR00413"
FT                   /protein_id="ADU05669.1"
FT                   /translation="MAARHLRTRKFSSPAAIAATAAVGVALAVGGTVGAVRLTSAEPPA
FT                   EPAVVETLPSTPAPTSAAPSPSASASPSASLSPSPKATPSPKASRTQAASRSKARTASP
FT                   SPTAKKTSSPKVVDSGSCGASFYAEGQMTANGETFNPDALTAAHKTLPFNTKVRVTNPA
FT                   NGKSVVVRINDRGPFIDGRCLDLSRAAFATIAATSLGHVNVRYEVLG"
     MAARHLRTRK FSSPAAIAAT AAVGVALAVG GTVGAVRLTS AEPPAEPAVV ETLPSTPAPT        60
     SAAPSPSASA SPSASLSPSP KATPSPKASR TQAASRSKAR TASPSPTAKK TSSPKVVDSG       120
     SCGASFYAEG QMTANGETFN PDALTAAHKT LPFNTKVRVT NPANGKSVVV RINDRGPFID       180
     GRCLDLSRAA FATIAATSLG HVNVRYEVLG                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page