(data stored in SCRATCH zone)

EMBL: CP002399.PE122

CP002399.PE122       Location/Qualifiers
FT   CDS             120872..121162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05676"
FT                   /inference="similar to AA sequence:KEGG:Sare_0087"
FT                   /protein_id="ADU05676.1"
FT                   /translation="MGIGASIFLIALGAIFAFAIDADLGWLNLNVVGWVLMLAGVAGLL
FT                   TTLYFWNSRRRVVAAPVREQVVAEPVVPVRDDRVVREEYREVRRPGSGYPA"
     MGIGASIFLI ALGAIFAFAI DADLGWLNLN VVGWVLMLAG VAGLLTTLYF WNSRRRVVAA        60
     PVREQVVAEP VVPVRDDRVV REEYREVRRP GSGYPA                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page