(data stored in SCRATCH zone)

EMBL: CP002399.PE123

CP002399.PE123       Location/Qualifiers
FT   CDS             complement(121227..121904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0123"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="manually curated; TIGRFAM: channel protein,
FT                   hemolysin III family; KEGG: saq:Sare_0093 hemolysin III
FT                   family channel protein; PFAM: Hly-III family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05677"
FT                   /inference="protein motif:TFAM:TIGR01065"
FT                   /protein_id="ADU05677.1"
FT                   /translation="MTTSAPFRLRPADIGKPRMRGWLHAYAFFAALVCGIVLCSIAAGR
FT                   PGWAPLVSCLIYSFTVCGLFGTSALYHRRVWTERGYQIMRRMDHSMIFVFIAGTYTPFC
FT                   ALLLDNRQATIMLSLVWGGAIAGVAVKLIWPHAPRWVSAPLYLALGWVAVAMLPQILHS
FT                   GGVTALVLLSVGGAIYSVGAVFYALRRPNPWPTVFGHHEFFHACTLVAAICHHIAIYFA
FT                   LFA"
     MTTSAPFRLR PADIGKPRMR GWLHAYAFFA ALVCGIVLCS IAAGRPGWAP LVSCLIYSFT        60
     VCGLFGTSAL YHRRVWTERG YQIMRRMDHS MIFVFIAGTY TPFCALLLDN RQATIMLSLV       120
     WGGAIAGVAV KLIWPHAPRW VSAPLYLALG WVAVAMLPQI LHSGGVTALV LLSVGGAIYS       180
     VGAVFYALRR PNPWPTVFGH HEFFHACTLV AAICHHIAIY FALFA                       225
//

If you have problems or comments...

PBIL Back to PBIL home page