(data stored in SCRATCH zone)

EMBL: CP002399.PE124

CP002399.PE124       Location/Qualifiers
FT   CDS             121980..122594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0124"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="KEGG: stp:Strop_0097 allophanate hydrolase subunit
FT                   1; PFAM: Allophanate hydrolase subunit 1; SMART:
FT                   Allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05678"
FT                   /inference="protein motif:PFAM:PF02682"
FT                   /protein_id="ADU05678.1"
FT                   /translation="MRIRPVGAHALLLDCDDAEQAQAWGAELWHRREAGELTATEIVPG
FT                   AVTVLLDGVPDPQAAAARIAAWHPRTAASGAATTEVRVPVVYDGEDIPLVAGHWNVDVP
FT                   AVVDRLRRTEFRVAFCGFAPGFAYLTGLPPELAVPRLATPRTRVPAGSVALAGPYAGIY
FT                   PAASPGGWLLVGRTDLPLFDVHADPPARLTPGTRVRLVDAS"
     MRIRPVGAHA LLLDCDDAEQ AQAWGAELWH RREAGELTAT EIVPGAVTVL LDGVPDPQAA        60
     AARIAAWHPR TAASGAATTE VRVPVVYDGE DIPLVAGHWN VDVPAVVDRL RRTEFRVAFC       120
     GFAPGFAYLT GLPPELAVPR LATPRTRVPA GSVALAGPYA GIYPAASPGG WLLVGRTDLP       180
     LFDVHADPPA RLTPGTRVRL VDAS                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page