(data stored in SCRATCH zone)

EMBL: CP002399.PE135

CP002399.PE135       Location/Qualifiers
FT   CDS             complement(137374..139077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0136"
FT                   /product="putative ABC transporter"
FT                   /note="KEGG: mkm:Mkms_1571 putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05689"
FT                   /inference="similar to AA sequence:KEGG:Mkms_1571"
FT                   /protein_id="ADU05689.1"
FT                   /translation="MSASKDGTVGNIVGRMREAMRGEQRVDPDTLIERLTAIQRFLGAV
FT                   DGHVPDAQLVAAHTVVERAGDRLALSGRHTVVALAGATGSGKSSLFNSLARLDLSPVGV
FT                   RRPTTGVAHACVWGPLDGAVRLLDWVGVLPRHRFVRESPLDADDESNLHGLVLLDLPDF
FT                   DSVQHGHRLEVDRLLGLVDLVVWVVDPQKYADRVIHTSYLREFHRHKDVTVVVLNQADR
FT                   LHPTELPKVLDDLRRLLDADGLGGVPLLPTVAVDPNGLEGLRTELERTVAERQAALRRL
FT                   SGDVDAVVADLEPLVGPEPPRTRPGDASAQELTRALAGAAGVPTVAAAVEGAYRHRAVS
FT                   NTGWPLLRSWRKLRPDPLRRLHLPGRDPDAPAESLVAATSVPDPTAAQRSALTLAIRAV
FT                   AERSGSGLPAPWPTAVTAAARARQADLPGALDHAVAATDLGMDRRPGWWRVVGVIQWVV
FT                   TLAALAGLAWLVLGYALRLLGLPPLEHPTLGVVPWPTVLLLGGLLAGLLVATVTRPVVG
FT                   WAARRARRRAEERLLTSVGSVGEKYVLDPVWAVLARYGTARDALREAGRR"
     MSASKDGTVG NIVGRMREAM RGEQRVDPDT LIERLTAIQR FLGAVDGHVP DAQLVAAHTV        60
     VERAGDRLAL SGRHTVVALA GATGSGKSSL FNSLARLDLS PVGVRRPTTG VAHACVWGPL       120
     DGAVRLLDWV GVLPRHRFVR ESPLDADDES NLHGLVLLDL PDFDSVQHGH RLEVDRLLGL       180
     VDLVVWVVDP QKYADRVIHT SYLREFHRHK DVTVVVLNQA DRLHPTELPK VLDDLRRLLD       240
     ADGLGGVPLL PTVAVDPNGL EGLRTELERT VAERQAALRR LSGDVDAVVA DLEPLVGPEP       300
     PRTRPGDASA QELTRALAGA AGVPTVAAAV EGAYRHRAVS NTGWPLLRSW RKLRPDPLRR       360
     LHLPGRDPDA PAESLVAATS VPDPTAAQRS ALTLAIRAVA ERSGSGLPAP WPTAVTAAAR       420
     ARQADLPGAL DHAVAATDLG MDRRPGWWRV VGVIQWVVTL AALAGLAWLV LGYALRLLGL       480
     PPLEHPTLGV VPWPTVLLLG GLLAGLLVAT VTRPVVGWAA RRARRRAEER LLTSVGSVGE       540
     KYVLDPVWAV LARYGTARDA LREAGRR                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page