(data stored in SCRATCH zone)

EMBL: CP002399.PE137

CP002399.PE137       Location/Qualifiers
FT   CDS             141161..143023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0138"
FT                   /product="chaperone protein DnaK"
FT                   /note="KEGG: saq:Sare_0112 molecular chaperone DnaK;
FT                   TIGRFAM: chaperone protein DnaK; PFAM: Heat shock protein
FT                   70"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05691"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ADU05691.1"
FT                   /translation="MARAVGIDLGTTNSCVSVLEGGEPTVIANAEGSRTTPSIVAFARN
FT                   GEVLVGEVAKRQAVTNPDRTIRSVKREIGTNWTVDIDGKKYTPQEISARTLMKLKRDAE
FT                   AYLGEQITDAVITVPAYFNDGQRQATKEAGEIAGFNVLRIVNEPTAAALAYGLDKGSKE
FT                   QTVLVFDLGGGTFDVSLLELAEGVVEVKSTSGDNQLGGDDWDQRIIDHLVKTFRGEHGI
FT                   DLSQDKMAMQRLKEAAEKAKIELSAATTSNINLPYITAGSAGPLHLDVTLSRAEFQRMT
FT                   QDLLDRCKGPFEQAVKDAGIKISDVDHVILVGGSTRMPAVTDLVKQLTGRDPNKGVNPD
FT                   EVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGIFTKLIERNTTIPTKRSEVFT
FT                   TADDNQPSVLIQVFQGERDIAAYNKKLGTFELTGLPPAPRGVPQIEVTFDIDANGIVNV
FT                   HAKDLGTGKEQKMTITGGSSLPKDDIERMRRDAEEHADEDKRRREEAETRNVAEALQWQ
FT                   TEKFLAESGDKLPGENRDQLNEALGELRSALGGQDIEKIKSAHEKLAQVSQQAGSLLYA
FT                   QQQEGEQTAPGAAGPGAGAGAAGGPKAGGDDDVVDAEIVDEDKK"
     MARAVGIDLG TTNSCVSVLE GGEPTVIANA EGSRTTPSIV AFARNGEVLV GEVAKRQAVT        60
     NPDRTIRSVK REIGTNWTVD IDGKKYTPQE ISARTLMKLK RDAEAYLGEQ ITDAVITVPA       120
     YFNDGQRQAT KEAGEIAGFN VLRIVNEPTA AALAYGLDKG SKEQTVLVFD LGGGTFDVSL       180
     LELAEGVVEV KSTSGDNQLG GDDWDQRIID HLVKTFRGEH GIDLSQDKMA MQRLKEAAEK       240
     AKIELSAATT SNINLPYITA GSAGPLHLDV TLSRAEFQRM TQDLLDRCKG PFEQAVKDAG       300
     IKISDVDHVI LVGGSTRMPA VTDLVKQLTG RDPNKGVNPD EVVAVGAALQ AGVLKGEVKD       360
     VLLLDVTPLS LGIETKGGIF TKLIERNTTI PTKRSEVFTT ADDNQPSVLI QVFQGERDIA       420
     AYNKKLGTFE LTGLPPAPRG VPQIEVTFDI DANGIVNVHA KDLGTGKEQK MTITGGSSLP       480
     KDDIERMRRD AEEHADEDKR RREEAETRNV AEALQWQTEK FLAESGDKLP GENRDQLNEA       540
     LGELRSALGG QDIEKIKSAH EKLAQVSQQA GSLLYAQQQE GEQTAPGAAG PGAGAGAAGG       600
     PKAGGDDDVV DAEIVDEDKK                                                   620
//

If you have problems or comments...

PBIL Back to PBIL home page